6667064. Sometimes i say stuff...
Sometimes i say stuff. The things that happen every day that are worth mentioning, but not really worth mentioning tomorrow, or next month, or next year. Thursday, August 30, 2012. I love Shark Week! It's pretty much the best week of the year. A whole week of awesome Shark Stuff plus it usually falls on the week of my birthday! This year I decided to have a Shark Week premiere party. We got to not only watch the premiere of the Shark Week programming but also enjoy foods fit for a. Monday, April 26, 2010.
sometimesisaystuff.blogspot.com 6667065. The Words that Connect Us | Musings from a college student
The Words that Connect Us. Musings from a college student. August 2, 2015. I think we need to start taking the adjectives off of people. Friend. This is my. Friend. This is my. Boyfriend. This is my rich. These adjectives only reiterate the distance we have, by reflex, put between us. But what we are left with is empty relationships. Relationships based on a flimsy label we constructed to make ourselves feel better. I hear so often from people “how do I make foreign friends? Rich, pretty, smart, connected.
sometimesisaythingssmart.wordpress.com 6667066. BORED - Sometimes I Scream
Powered by: rightHAND designs.
sometimesiscream.co.za 6667067. sometimes i scream at the sky | God, Jesus, rock n roll,motorcycles and the outcasts of society
Sometimes i scream at the sky. God, Jesus, rock n roll,motorcycles and the outcasts of society. December 16, 2016. Christianese and the jargon of faith! LISTEN: One of the big ones, if you listen to what a person is saying, you can gauge how to speak to them about faith. CERTAIN WORDS WILL BE USED: In some cases we can’t escape jargon, its going to happen, as it happens in all conversations. But what we can do is cut down on the amount of jargon we use, this is no bad thing. November 29, 2016. The birth ...
sometimesiscreamatthesky.wordpress.com 6667068. Sometimes I Think I See Things Other People Do Not
Sometimes I Think I See Things Other People Do Not. If you're like me, then you know me. Sunday, October 24, 2010. Sorry I've Been So Busy With School You Guys. I call this one, "I Hope You Enjoy Making Below Minimum Wage At That Ice Cream Gig Tyler, Because It's Not Like That Art Degree Is Going To Really Get You Anywhere.". Only he who hangs himself from the tree. The tree of the fruit of all knowledge). Will be plucked and consumed in the glorious gloom. In those darkest of days we call college. Outsi...
sometimesiseethings.blogspot.com 6667069. SometimesIsing (...in the shower!) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 4 Years. This deviant's activity is hidden. Deviant since Jun 24, 2012. This is the place where you can personalize your profile!
sometimesising.deviantart.com 6667070. Courtney Barnett | Sometimes I Sit and Think, and Sometimes I Just Sit
Special edition 2XLP yellow vinyl, 4 Polaroids and 7 bonus tracks. Special Edition LP Package - BUY. Special edition boxset, 4 Polaroids, 6 bonus tracks a download of John Cale's "Close Watch." - $31.99. Special Edition CD Package - BUY.
sometimesisit.momandpopmusic.com 6667071. sometimesisitsandthinks « The greatest WordPress.com site in all the land!
The greatest WordPress.com site in all the land! Crossing the Road (and Reading the Bible) with a Post-Modernist…. What if she suddenly went insane? What if she simply decided to opt out of the convention? But is all such conditioning necessarily good? There are differences in perception at such a deep level that we may not even be speaking the same language! Is it exactly the same as I see? In the path of such incredibly fast change, the conventions are stretched and strained, and often break down entir...
sometimesisitsandthinks.wordpress.com 6667072. www.sometimesisland.com
This site is under construction. Why am I seeing this page? Are you the owner of this domain? How to replace this page. Try these searches related to www.sometimesisland.com:. Sometimes Islands Lake Travis. Island In the Caribbean. Sanibel Island Captiva Island. Island Inn Treasure Island. Treasure Island Cayman Island.
sometimesisland.com 6667073. Sometimes I Sleep « other times, I pretend
Other times, I pretend. I’m the Only Mom My Kids Have. Sorry, Kids. People say that I must be an amazing mother. Really, they say it. I don’t know what gives them that impression. I probably talk a good talk. But there is one thing these sweet people have in common- they don’t see my mothering. If they did, they’d declare my children amazing for thriving in my haphazard parenting. To be fair, in the beginning, I was bored. I was used to spending my days with other musicians, playing, practicing, goin...
sometimesisleep.com 6667074. Melancolía patológica
A = 440[1/s]. o sea Hz. Monday, September 01, 2014. The pain of my pain is that it (mostly) is an imaginary pain. A la hora que dice aquí:. Por mi compulsión puse esto en: Pseudoabstracciones. Saturday, August 23, 2014. Pavor a la intimidad y esto: el blog. A la hora que dice aquí:. Por mi compulsión puse esto en: Retro-reflecto. Tuesday, June 17, 2014. A la hora que dice aquí:. Por mi compulsión puse esto en: Retro-reflecto. Saturday, November 23, 2013. A la hora que dice aquí:. Friday, November 09, 2012.
sometimesispitacid.blogspot.com 6667076. Cottage Garden Samplings' Blog
Sunday, May 12, 2013. Today is one special day of year. Let's celebrate! I believed this amazing video will make you roll with laughter. I wish all Moms, Grandmoms. A very Happy Mother's day! Friday, April 5, 2013. May's Lily of the Valley. This is May's Lily of the Valley. The new released after April's Daisy. Part 5 of "My Garden Journal" series. My website has been updated. For more details of this chart, please click HERE. Cottage Garden Samplings will be one of the vendors in. April 18 - 23. Stitche...
sometimesistitch.blogspot.com 6667078. Protected Blog › Log in
Https:/ sometimesistitch.wordpress.com/. Is marked private by its owner. If you were invited to view this site, please log in. Below Read more about privacy settings. Larr; Back to WordPress.com.
sometimesistitch.wordpress.com 6667079. Sometimes, I surf
Sometimes, I surf. How strange it was to see men doing something beautiful. Something pointless and elegant. quote from Tim Winton's book 'Breath'. Completed OME board spray. 11/06/2013 – 4:03 pm. 09/10/2012 – 10:10 am. 05/10/2012 – 12:36 pm. Work in progress on a new board spray. 03/06/2012 – 10:17 pm. Daniel Thomson of Tomo Surfboards board design interview 2012. 09/05/2012 – 11:53 am. 30/04/2012 – 10:00 am. A new film by Albert Falzon and Andrew Kidman. 24/04/2012 – 10:32 am. 02/04/2012 – 2:47 pm.
sometimesisurf.com 6667080. SometimesITalkAboutSex.com | My Blog
SOMETIMES I TALK ABOUT SEX. Let’s talk about freaking out. Wait, let’s be more specific. Let’s talk about when Axel and I were in Puerto Rico for a wedding , and I was premenstrual and convinced that I had been shipwrecked and starved on PR in a previous life. I mean I have the fungus, not the wedding. In October my right big toenail had came right off, I guess from doing too much running and hiking in the wrong shoes. It was so freaky that I took my left big toenail off too. Why? Luckily I have a predil...
sometimesitalkaboutsex.com 6667081. sometimes I talk to strangers
Sometimes I talk to strangers. Kids and their People. Wednesday, July 2, 2014. It's been a while. I used to update my blog all the time and then this happened. And then.this happened! My "big" girl is now 18 months old and her baby sister is 9 days today. and momma has some updating to do. We've had some big changes (besides the obvious change of our whole world revolving around two tiny humans). Our next biggest change was a move to Redlands! And you can literally see the love on their faces. And this i...
sometimesitalktostrangers.blogspot.com 6667082. .cerita biasa.
Dec 9, 2010. Satu hari dua hari tiga hari empat hari lima hari enam hari tujuh hari lapan hari sembilan hari sepuloh hari.okay dh sepuloh hari kat umah. Tak banyak aktiviti yang aku buat setakat nie.ada la lepak dgn bestfren aku.dh jauh nie rasanya aku rindu kan seseorang.huhuu. Cermin ku membayang bayanganmu. Pameran kasih ku layu. Tiada dirimu tiada untukku. Tinggalkan ku dalam anganmu. Kau hilang terus kau menyepi. Tewasku bila ku ketahui. Berita kau sudah berpunya. Hilangku bukan kerana cinta. P/s: I...
sometimesitcanbewonderful.blogspot.com 6667083. Sometimes It Comes Down To This
Sometimes It Comes Down To This. If You Have Ever Went Through Some Of The Blogs On This Wonderful Site, I Bet That You Have Seen That Most Of Them Are About happy couples, businesses, and women talking about their kids, But Me? I'm Just A Teen-aged Girl Of This Century. Enjoy My Life And Ranting! Go Ahead, Behold My Blog, I Allow You. Monday, September 30, 2013. Enjoy This Story I Wrote For Creative Writing And Just Submitted To Creepypasta.com. Enjoy this while I sort my crap out. Could they be taller?
sometimesitcomesdowntothis.blogspot.com 6667084. sometimes it feels like gymnastics is all people see.
sometimesitfeelslikegymnasticsisallpeoplesee.info 6667085. Home - Sometimes It Happens
sometimesithappens.com 6667086. Sometimes it Happens at Night
Sometimes it Happens at Night. Moments of clarity and tidbits of inspiration. Monday, September 15, 2014. I was asked by the Georgetown Art Center. The sky did not fall. BUT, for this talk, I would not have my slides to prompt me, so I decided to write it all down here and then post it, after my talk, so that anyone who had an interest would have an opportunity to read what I managed to say. Anyway here's an excerpt of the original written speech. Spring, Everything Changes. 2010, oil on canvas, 54x42".
sometimesithappensatnight.blogspot.com 6667087. Plans don't mean anything
Plans don't mean anything. I'm Carol and I'm forever alone and forever reblogger. I Love Justin Timberlake, Esmée Denters, Demi Lovato, Friends, Grey's Anatomy, Glee, Once Upon A Time,Doctor Who, 2Broke Girls. When I’m gone, when I’m gone. You’re gonna miss me when I’m gone. Tell me where I am. I d e m a n d you tell me, right now, where am I? Grey’s Anatomy ladies. Not people in general, it seems. Grey’s advent calendar. When the red light just turns green and somebody is already beepin at you.
sometimesithastobethisway.tumblr.com 6667088. Sometimes it has to hurt
Sometimes it has to hurt. Miłego Czytania ;*. Sobota, 24 stycznia 2015. Ja muszę iść , pa - powiedział i szybkim krokiem zaczęła iść w stronę auta . Wiedząc , od razu , że moja kochana mama jest mono tematyczna ( zadaje dużo pytań , powtarza się ) głośno westchnęłam i wepchnęłam się do dużo czerwonego samochodu , siadając wygodnie . Kochanie pasy . - udając , że nie słyszałam pytania ,gapiłam się bez sensu na drogę . Kelsey , no szybciutko! Tak , kto mówi? Boże haha - nie wiedziałam co powiedzieć. No Kel...
sometimesithastohurt.blogspot.com 6667089. Motivational and Inspirational Search Engine
Anyone who has never made a mistake has never tried anything new.
sometimesithelps.com 6667090. Sometimes I Think
Because sometimes someone has to be a part-time thinker! Sunday, December 15, 2013. John was In the hospital a lot recently. My husband, John, has been in the hospital a lot recently. I've lost track of the number of times, but I think he's had six hospitalizations in the past few months. Three of John's hospitalizations were for graham negative and graham positive infections. During the last hospital stay John actually got sepsis. He had a graham positive infection in his blood. Her telling John the tru...
sometimesithink-krissy.blogspot.com 6667091. -WITTY STATEMENT HERE-
Wednesday, 10 March 2010. THIS SITE IS UNDER MAINTENANCE. YES, FOR A LONG TIME. Eating it from the inside. Links to this post. Wednesday, 9 December 2009. Links to this post. Tuesday, 17 November 2009. I found this new option on blogger, its called reactions, as in your reactions from reading my posts. so at the end of each post there would be a three options: HAHAHA:D, WOAH. and HUH? So i encourage (haha wouldn't it be funny if it was pronounced as an-co-raage) you to click one of 'em :D YAY! Wednesday,...
sometimesithinkfairiesexist.blogspot.com 6667092. Sometimes I Think I'm Funny
Sometimes I Think I'm Funny. February 8, 2014. It’s almost time…. To celebrate my 26th birthday! And you’re invited! But to be completely honest…. This is how I feel:. It’s like totally okay, though. I mean… This was Britney at 26:. And this is me:. I’d say I’m doing pretty great! I recently started a new job. I now have Will in my life. I’m still skinny. And I’ve got amazing friends. So to kick off another great year. I invite you to join me. And lots of smiles and laughs. So, I hope you say:. New Music...
sometimesithinkimfunny.com 6667093. My Twisted Mind is Always Wrong
My Twisted Mind is Always Wrong. Another narcissistic tumblr where I put everything who came through my mind. Breathed so deep I thought I’d drown Lorelei Black x Anastasia Kole. If you don’t work your magic! Iowa barber gives haircuts to children in exchange for them reading stories to him. DUBUQUE (AP) Children who read books to a local barber have received a free haircut as part of a community event in Dubuque to help families prepare for the upcoming school year. I could just cry. Your parents encour...
sometimesithinkimmad.tumblr.com 6667094. Sometimes I Think I Should Go | 'Not all those who wander are lost'…some are wanderlust….
Sometimes I Think I Should Go. 039;Not all those who wander are lost'…some are wanderlust…. 6 de Agosto de 2015. 6 de Agosto de 2015. Deixe o seu comentário. 23 de Maio de 2015. 23 de Maio de 2015. Deixe o seu comentário. Let’s validate. Let’s be kind to one another. It’s worth every minute! PS You can also follow me on tlumbr: http:/ sometimesithinkishouldgo.tumblr.com/. Beauty is in the eye of the beholder. Is it, really! Or we must reset our minds! 8 de Maio de 2015. 8 de Maio de 2015. Deixe o seu com...
sometimesithinkishouldgo.wordpress.com 6667095. If Nothing ventured, Nothing Earned.
If Nothing ventured, Nothing Earned. Https:/ www.facebook.com/eumechamoantonio. Marilyn by Ed Feingersh, 1955. In defence of hooking up – in university and beyond Jill Filipovic Comment is free guardian.co.uk.
sometimesithinktoomuch.tumblr.com 6667096. sometimesithurts (mia) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 12 Years. This deviant's full pageview. Last Visit: 222 weeks ago. This is the place where you can personalize your profile! With f...
sometimesithurts.deviantart.com 6667097. Rocket Science Handyman Services | ... Because Sometimes, It Really Is.
Skip to main content. The To-Do List. Every home has one. Not every home has someone with the skills, time or patience to tackle it. That's where Rocket Science Handyman Services comes in! Why Choose Rocket Science? Your time is worth a lot! By investing in quality, affordable handyman services, you free up time to do things you enjoy while eliminating the guilt of unfinished projects or worries about the deterioration or safety of your home. What's in a Name? Rocket Science" isn't just a catchphrase.
sometimesitis.com 6667098. Sometimes It Is Lupus
Wednesday, 12 August 2015. Want to Help Medical Research? I've heard about a couple of studies that lupies may possibly be interested in helping with. Firstly a local one (well, Brisbane, which is close to local). Medical Photographer Kara Burns at the Queensland University of Technology is doing a study on medical selfies, and how taking photos of rashes, moles and other oddities could help with patients medical treatment. If you have an interesting rash to share, Kara would love to hear from you. Brain...
sometimesitislupus.com 6667099. Sometimesitlastinlove's blog - Sometimes it lasts in love , but sometimes it hurts instead... <3 - Skyrock.com
More options ▼. Subscribe to my blog. Created: 04/05/2012 at 10:38 AM. Updated: 11/05/2012 at 10:49 AM. Sometimes it lasts in love , but sometimes it hurts instead. 3. Chaque journée a une fin et une morale , elle se succèdent et s'enchaîne. Même si parfois on a pas le moral. On se sent pas a sa place , on veut tout foutre en l'air. Mais il y a toujours une chose qui nous empeche de vraiment tout détruire,. Même si on a pas vraiment quoi que se soit a quoi s'accrocher . Don't forget that insults, racism,...
sometimesitlastinlove.skyrock.com 6667100. Blog de Sometimesitlastsinlove - Parfois l'amour dure. - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Plus d'actions ▼. S'abonner à mon blog. Création : 24/10/2011 à 05:54. Mise à jour : 17/10/2012 à 13:38. Parfois l'amour dure. Ce blog n'a pas encore d'articles. Abonne-toi à mon blog! Poster sur mon blog.
sometimesitlastsinlove.skyrock.com 6667101. Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
sometimesitrains.com 6667102. Sometimes It Rains
Babies Touch The World With Love. My Journey To Fertility. Trust In Our Savior. No public Twitter messages. And We’re Back. March 8th, 2012. It is currently have some issues so it might not work 100% but bare with me and we’ll get things figured out. Blog Theme by LJP.
sometimesitrains.org 6667103. Blog de sometimesitrains - ma vie a moi - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Ma vie a moi. Ba voila jm'apelle astrid é ge fé se blog pour ke vs me conaissé un peu bon ba jvs souéte une bone visite é laissé d com's. Mise à jour :. Abonne-toi à mon blog! N'oublie pas que les propos injurieux, racistes, etc. sont interdits par les conditions générales d'utilisation de Skyrock et que tu peux être identifié par ton adresse internet (67.219.144.114) si quelqu'un porte plainte. Ou poster avec :. Posté le dimanche 07 janvier 2007 12:19. N'oub...
sometimesitrains.skyrock.com 6667104. Sometimes it Rains in Portland
Sometimes it Rains in Portland. The ever changing search for sunny skies. I find my life extremely boring and uninteresting. Therefore, it only makes sense for me to start a blog and share the daily excitement with friends. Look for fascinating topics like "why the cereal and alcohol diet really works", "fun times at the hardware store" and "the abc's of incompetence". Enjoy! Rudolph in Red-Earthed Africa. Rudolph in Red-Earthed Africa. Monday, December 21, 2009. Friday, December 11, 2009. The only way t...
sometimesitrainsinportland.blogspot.com 6667105. easyDNS Parked Page for: sometimesitrhymes.com
Sometimesitrhymes.com is a parked domain. 10 Things you must. Know before you register your domain name with anybody. For a concise 1-page explanation as told by a domain industry insider, click here. We provide responsive customer support to assist you with your domain account. You can email our support staff anytime, day or night, or call our toll-free support line. During regular business hours. DNS Hosting and Management. 2015 easyDNS™ Technologies Inc. Looking for suggestions . Domain Policy and Law.
sometimesitrhymes.com 6667106. Sometimes it's all just words
Sometimes it's all just words. Saturday, June 2, 2012. I'm not a fan of Rep. Mick Mulvaney's politics and policy positions, but I do like the man. Even if I didn't like him, I'd have attest to the fact that not only is he intelligent, but also, a recent report to the contrary, a good public speaker. Study: Mulvaney's speeches least advanced in Congress. Now, maybe he's losing points for being colloquial and if that's so, it's unfair. His views may be stuck in the 1950s, but you can't fault the guy fo...
sometimesitsalljustwords.blogspot.com 6667107. sometimesitsbad (Zhenya) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) " class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 7 Years. This deviant's full pageview. Last Visit: 390 weeks ago. This is the place where you can personalize your profile! By moving, adding and personalizing widgets. Why," you ask?
sometimesitsbad.deviantart.com 6667108. Protected Blog › Log in
Https:/ sometimesitsbetteroutthanin.wordpress.com/. Is marked private by its owner. If you were invited to view this site, please log in. Below Read more about privacy settings. Larr; Back to WordPress.com.
sometimesitsbetteroutthanin.wordpress.com 6667109. sometimes it`s hard to be me
THE TRUTH IS YOU DON'T KNOW WHAT'S GOING TO HAPPEN TOMORROW. LIFE IS A CRAZY RIDE AND NOTHING IS GUARANTEED. Moi Onko ok tulla aina kirjoittelemaan tänne silloin tällöin? Nykyään tästä on tullut mulle vähän niinkuin joku pakopaikka. Joku paikka, jonne voi tulla höpöttelemään, kun siltä tuntuu. Nyt tuntuu taas siltä, että tekee mieli kirjotella. Jotenkin se helpottaa saada ajatuksia kasaan. Joka kerta satutat itseäs, sillä oot päästänyt itses liian lähelle jotakin toista. Kun näin käy tarpeeks monta kerta...
sometimesitshardtobeme.blogspot.com 6667110. Sometimes It's Hard to Grasp
Bull; Completed Stories. Bull; Uncompleted Stories. You can call me Miguelito. Our Boys and a trip down memory lane. (2010-2012). [x]. I just rewatched this and felt super sentimental. It’s weird how much can change in 3 years. Floop is a bad guy, help us save us. Just when I think I’ve moved on with my life, 1D does shit like this, and sucks be back in. One Direction is on Corden's show tonight. I don't care. I'm over them. Damn't. No I'm not. Record it. Shit. Those assholes. IMNAGINE YOUR OT3 FDJSKGL.
sometimesitshardtograsp.tumblr.com 6667111. Spicy Cajun Seasonings & Hot Sauces by Sometimes it's Hotter Seasoning Company
We've moved to 112 East Gulf Beach Drive - Come visit us! Welcome to Sometimes It's Hotter! We hope your visit here will encourage you to spice up your life! Sometimes It's Hotter Seasoning Co. has been providing fine, all natural seasonings for discriminating consumers since 1997. We pride ourselves on our attention to detail and use only the finest ingredients. From salsas to rubs to the painfully hot, we provide everything for a spicy feast. An all natural product. No preservatives or MSG. Our Snack N...
sometimesitshotter.com 6667112. Sometimes, it's just a cigar | This is our truth, tell us yours
Sometimes, it's just a cigar. This is our truth, tell us yours. A free lesson in framing for New Labour. A free lesson in framing for New Labour. New Labour, the rump of the organization Blair won with, need a few lessons in how to frame a debate. Either that, or like John Cruddas’s survey about ‘living within … Continue reading →. August 15, 2015 · Leave a comment. I dont like Paloma Faith either but…. I dont like Paloma Faith either but…. August 14, 2015 · 1 Comment. The A level blues. The A level blues.
sometimesitsjustacigar.wordpress.com 6667113. Sometimes It's October
sometimesitsoctober.com 6667114. Action Coming Soon
Get Ready to Party Something Heavy, Fuckers. Powered by InstantPage® from GoDaddy.com. Want one?
sometimesitsok.com 6667115. Sometimes It's Okay
He won't call you back.
sometimesitsokay.com 6667116. Sometimes it's ok to be the oldest!
Sometimes it's ok to be the oldest! Thursday, June 27, 2013. My mom told us a few weeks ago that we got ticket to fly to New Hampshire. First we will drive to LA and then hang out for a few days then to NH i am so excited. Saturday, February 16, 2013. I miss living in New Hampshire! So I wrote this story. (this story is meant for James) I miss one of my Best Friend (James). Me and James last summer. I have something to tell you," Jess said to James. Do you want to see the fort I made down by the bank?
sometimesitsoktobetheoldest.blogspot.com 6667118. Sometimes It's Peaceful
Home education in England: the politics. Friday, June 19, 2015. A critique of Daniel Monk's 2009 article and the reasons why. In 2009, Daniel Monk. Wrote his article Regulating home education: negotiating standards, anomalies and rights. This then formed the basis of the Badman Review. Presumably deliberately, as it makes several references throughout to 'the forthcoming review', though I do not know to what extent Mr Monk was involved in the instigation of the review, if any. His personal view of home e...
sometimesitspeaceful.blogspot.com 6667120. Sometimes It's Personal
This is just me, wittering on about me and some non-specific family-type stuff. Well, I've got to do it somewhere. Tuesday, 1 March 2011. My [not so secret] life ambition. I'm building a village. Making a start - however small and slow - in the field. With 'studio bedrooms' for the older children. What do I mean by 'village'? Why do I want to build one? Unless there is that deep, familial bond of love involved - ditto the care of old people. And each other! Take a village to raise a child, and to educate...
sometimesitspersonal.blogspot.com 6667121. Sometimes It's Philosophical
Pondering and pontificating. Actually just talking to myself. These are the things I most need to learn and remember. Sunday, January 30, 2011. On extended family living. Someone came up with a better name for this a few years ago and I can’t remember what it was, but I’m pretty sure I blogged it at the time. OK, it’s 3G living. I touched on it by that name in this post. And in a bit more detail and in a bit of a rant back in 2007 here. First, why are we doing this? How did we manage that? There’s good c...
sometimesitsphilosophical.blogspot.com