SWIFTTRAVEL.COM
Premium travel made affordable / Swift TravelAccess exclusive flight offers, hotels and services with Swift
http://www.swifttravel.com/
Access exclusive flight offers, hotels and services with Swift
http://www.swifttravel.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
1 seconds
16x16
32x32
64x64
128x128
Swift Travel
Paul Riddle
21 Br●●●●●trood
Lou●●●ton , ESS, IG10 2SB
GB
View this contact
Swift Travel
Paul Riddle
21 Br●●●●●trood
Lou●●●ton , ESS, IG10 2SB
GB
View this contact
1&1 Internet Ltd.
Hostmaster ONEANDONE
10-14●●●●● Road
Sl●●gh , BRK, SL1 3SA
GB
View this contact
BUY YOUR DOMAIN
26
YEARS
2
MONTHS
27
DAYS
1 & 1 INTERNET AG
WHOIS : whois.schlund.info
REFERRED : http://1and1.com
PAGES IN
THIS WEBSITE
2
SSL
EXTERNAL LINKS
13
SITE IP
52.16.59.19
LOAD TIME
0.953 sec
SCORE
6.2
Premium travel made affordable / Swift Travel | swifttravel.com Reviews
https://swifttravel.com
Access exclusive flight offers, hotels and services with Swift
swifttravel.com
Organise your next trip with us / Swift Travel
https://swifttravel.com/destinations
Talk to a Swift Specialist. Organise your next trip with us. We have 30 years experience providing travel services to destinations worldwide. British Midland Airways Ltd. El Al Israel Airlines. Take the time to browse destinations below or do a quick search above. See all Australia flights. Rtn From 1553.60. Rtn from 1553.60. London (LHR) - Perth (PER). Perth (PER) - London (LHR). Rtn from 1614.46. London (LHR) - Sydney (SYD). Sydney (SYD) - London (LHR). Rtn from 1692.60. London (LHR) - Melbourne (MEL).
Plan your trip with us / Swift Travel
https://swifttravel.com/enquiry/flight
Talk to a Swift Specialist. Plan your trip with us. Enter your requirements and one of our specialists will contact you with the best options. What dates are you planning to go? How shall we contact you? British Midland Airways Ltd. El Al Israel Airlines. I need to hire a car / Organise a transfer. Prices shown are per person, inclusive of taxes/fees and are subject to availability. Swift Travel respects your privacy and does not share or sell your details with any third parties. Need an instant quote?
TOTAL PAGES IN THIS WEBSITE
2
Flight Enquiry to USA - SwiftTravel.com
http://swiftusa.co.uk/enquire.asp
Fort Lauderdale, FL. Las Vegas, NV. Los Angeles, CA. New York City, NY. San Francisco, CA. Washington DC, DC. Atlantic City, NJ. Baton Rouge, LA. Carson City, NV. Cedar Rapids, IA. Corpus Christi, TX. Des Moines, IA. Fort Myers, FL. Fort Smith, AR. Fort Wayne, IN. Grand Canyon, AZ. Grand Forks, ND. Grand Island, NE. Grand Rapids, MI. Great Falls, MT. Hot Springs, AR. Jackson Hole, WY. Kansas City, MO. Key West, FL. Little Rock, AR. New Orleans, LA. New York (Metropolitan), NY. Oklahoma City, OK.
Special Offers on Flights to USA - SwiftTravel.com
http://swiftusa.co.uk/offers.asp
We are currently pricing special airfares for our destinations. Please check back with us again soon. 2009-2013. Swift Travel. 199a High Road. Loughton. Essex. IG10 4LF. ATOL No 5950. ABTA No A5471.
Flights for Cruises - SwiftTravel.com
http://swift-flights.co.uk/cruise_flights.asp
599 taxes Premium New York to London. 624 taxes Premium Boston to London. 1509 taxes Business Class Miami to London. 1802 taxes Business Class Vancouver to London. 2005 taxesFirst Class San Francisco to London. Don't see your destination? Cruiseflights@swifttravel.com ». Call us now on:. Save up to 40% off on Premium Economy, Business Class and First Class Worldwide Flights for Cruise Passengers.
Flight Enquiry to Worldwide Cities - SwiftTravel.com
http://swift-flights.co.uk/enquire.asp
Would you like to Join our Newsletter? NB: Prices subject to availability and in some circumstances taxes/fees may apply, in most cases CHILD DISCOUNTS can be obtained. 2009-2013. Swift Travel. 199a High Road. Loughton. Essex. IG10 4LF. ATOL No 5950. ABTA No A5471.
Flight Enquiry to USA - SwiftTravel.com
http://www.swiftusaflights.com/enquire.asp
Fort Lauderdale, FL. Las Vegas, NV. Los Angeles, CA. New York City, NY. San Francisco, CA. Washington DC, DC. Atlantic City, NJ. Baton Rouge, LA. Carson City, NV. Cedar Rapids, IA. Corpus Christi, TX. Des Moines, IA. Fort Myers, FL. Fort Smith, AR. Fort Wayne, IN. Grand Canyon, AZ. Grand Forks, ND. Grand Island, NE. Grand Rapids, MI. Great Falls, MT. Hot Springs, AR. Jackson Hole, WY. Kansas City, MO. Key West, FL. Little Rock, AR. New Orleans, LA. New York (Metropolitan), NY. Oklahoma City, OK.
Flight Enquiry to USA - SwiftTravel.com
http://swiftusaflights.co.uk/enquire.asp
Fort Lauderdale, FL. Las Vegas, NV. Los Angeles, CA. New York City, NY. San Francisco, CA. Washington DC, DC. Atlantic City, NJ. Baton Rouge, LA. Carson City, NV. Cedar Rapids, IA. Corpus Christi, TX. Des Moines, IA. Fort Myers, FL. Fort Smith, AR. Fort Wayne, IN. Grand Canyon, AZ. Grand Forks, ND. Grand Island, NE. Grand Rapids, MI. Great Falls, MT. Hot Springs, AR. Jackson Hole, WY. Kansas City, MO. Key West, FL. Little Rock, AR. New Orleans, LA. New York (Metropolitan), NY. Oklahoma City, OK.
Special Offers on Flights to USA - SwiftTravel.com
http://www.swiftusaflights.com/offers.asp
We are currently pricing special airfares for our destinations. Please check back with us again soon. 2009-2013. Swift Travel. 199a High Road. Loughton. Essex. IG10 4LF. ATOL No 5950. ABTA No A5471.
Special Offers on Flights to USA - SwiftTravel.com
http://swiftusaflights.co.uk/offers.asp
We are currently pricing special airfares for our destinations. Please check back with us again soon. 2009-2013. Swift Travel. 199a High Road. Loughton. Essex. IG10 4LF. ATOL No 5950. ABTA No A5471.
TOTAL LINKS TO THIS WEBSITE
13
Swift Transport Training | Belfast | Northern Ireland
Tel : 028 9066 1606. E-Mail : info @swifttransporttraining.com. Thank you for visiting our site. Swift Transport Training Ltd. has been providing driver training for over 20 years and has built up a reputation for first class service with a personal, friendly approach. Our offices are situated in Stockmans Lane, Belfast, at junction 2 of the M1 where we provide booking and classroom training facilities. All our instructors are professional, highly experienced and qualified.
Electric Mouse Trap
Monday, 24 October 2011. Get the best electric Mouse Trap. Electric mouse trap is the most innovative invention to trap mouse without any stress. It is the best alternative to trap mouse without any harm. Most of the people love animals and therefore, they do not want to kill small mouse or mice by some inhumane way. Electric mouse trap. Helps those people to trap mouse without provide any physical harm. Both the traditional as well as electronic mice traps. Before using an electronic mouse trap. Is the ...
swifttrap | Just another WordPress.com site
Just another WordPress.com site. Get the best electric Mouse Trap. October 25, 2011. Electric mouse trap is the most innovative invention to trap mouse without any stress. It is the best alternative to trap mouse without any harm. Most of the people love animals and therefore, they do not want to kill small mouse or mice by some inhumane way. Electric mouse trap. Helps those people to trap mouse without provide any physical harm. To indicate that mouse has been killed. Now the only thing with the per...
Airport Transfers - York | Swift Travel
Airport Transfers - York Swift Travel home page. Executive travel in York, travelling across UK. Swift Travel have been providing quality executive travel and airport taxi services in York for over 16 years. Specialising in airport transfers, we cover all UK airports including Manchester, East Midlands, Newcastle, Gatwick and Heathrow. Why choose our taxi service? Smartly dressed driver at all times. Luxury vehicles including a Mercedes Viano. Complimentary water and mints in vehicles.
Premium travel made affordable / Swift Travel
Talk to a Swift Specialist. Premium travel made affordable. Access exclusive flight offers, hotels and services with Swift. Rtn from 511.00. London (LHR) - Dubai (DXB). Dubai (DXB) - London (LHR). Rtn from 693.00. London (LGW) - Orlando (MCO). Orlando (MCO) - London (LGW). Rtn from 734.00. London (LGW) - Tampa (TPA). Tampa (TPA) - London (LGW). Rtn from 763.00. Manchester (MAN) - New York (JFK). New York (JFK) - Manchester (MAN). Rtn from 764.00. London (LHR) - Delhi (DEL). Delhi (DEL) - London (LHR).
Swift Travel | The best travel companion you can get
Call us now: 92 (21) 3583 7766. To Travel is to live. Want to make a journey? We’ve got the destinations! We provide top rated services which enables you to save time and money. You get better flight connections, value for your money & better travel deals. One of our highly trained travel managers will be at your service 24/7. Alone or in groups…. Traveling was never easier! Want a family vacations abroad or within Pakistan? Planning one in a lifetime honeymoon by the beach? A few of our.
Swift Travel search for lowest fares from Swift Travel
Flight specialists since 2001. Welcome to Swift Travel. Search over 100 airlines for cheapest international flights from and to all countries, pay in 26 different currencies and credit cards. By using the comprehensive Swift Travel resources you will be able to search for flight date, destination and flight departure airport, for the flights to suit your individual travel requirements. Have a good cheap flight from Swift Travel UK. Swift Travel travel guides. South East Asia travel. Music from Spiral Frog.
HEM
Swift Travel ingår numera i Scanworld Lufthansa City center. Vänligen besök scanworld.se. För ytterligare information. För att komma i kontakt med oss, vänligen ring 08-475 00 40 eller maila: grupp@scanworld.se.
swifttravelandtour.com - This website is for sale! - swifttravelandtour Resources and Information.
The owner of swifttravelandtour.com. Is offering it for sale for an asking price of 1000 GBP! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
swifttraveldeals.americanpassportnow.com
American Passport Now
Lost or Stolen Passport. Tips for Women Travelers. Travel Document Solutions Experts. A Proud Partner of Swift Travel Deals. Is a well-established passport and visa expediting company and a. Proud partner to Swift Travel Deals. Our mission critical services are focused strictly on. When time is of the essence. In your global business, Meeting deadlines. For global travel is ours! What type of service do you need? 40 Years of Experience. Low Rates and Rush Delivery. US Department of State Licensed.
SOCIAL ENGAGEMENT