3349616. theschindlers.com -
To purchase theschindlers.com, call Buydomains.com at. Call today for daily specials. Get A Price Quote. Use our quick form below. Please enter your First and Last Name. Please enter your Email Address. Please input a valid email. British Indian Ocean Territory. Burkina Faso (formerly Upper Volta). Heard and McDonald Islands. Lao People's Democratic Republic. Saint Kitts and Nevis. Saint Pierre and Miquelon. Saint Vincent and the Grenadines. Sao Tome and Principe. Svalbard and Jan Mayen Islands.
theschindlers.com 3349617. The schingeck team Award Winning Real Estate Team/
Our experience with the Schingeck Team was amazing! My husband and I highly recommend the Keller Williams Realty team to anyone and everyone who will listen. GO TEAM SCHINGECK! Ndash;Denise and Brian Bezenah - Brighton, MI. The Schingeck team, Kevin and Candance were referred to us by a long time family friend.Kevin and Candace Schingeck are knowledgeable, friendly professionals. They were available when we needed them. I would recommend them to anyone.". Ndash;Dave and Cheryl Murdza - Livingston County.
theschingeckteam.com 3349618. The Schinns
February 4, 2016. We flew from Milan to Berlin on 3 hours of sleep. We stayed in a place through Airbnb again – my favorite from the trip. It was a spacious apartment in an old building in Neukolln, with hardwood floors, beautiful decor, and stunning art. The host was Freeda, who uses the apartment as her art studio (hence the great art). February 4, 2016. First stop on our Europe trip: Milan. In Milan we stayed in an apartment via Airbnb. Our host was a cool Dutch guy, Alexander. In the Roma Venezia dis...
theschinns.wordpress.com 3349619. Les Meilleurs Thés de Chine | Thés Chinois
Lu An Gua Pian. Tai Ping Hou Kui. Thés de Roche (Yancha). Qi Men Hong Cha. Tan Yang Gong Fu. Bai Hao Yin Zhen. Conditions Générales. Pu Erh Fermenté Dayi V93 - 100 gr. Pu Erh Brut Xiaguan FT Zi Yun Hao - 100 gr. Pu Er Brut Xiaguan Fei Tai n 6 - Tuo Cha 100 gr. Pu Er Brut Xiaguan - 2013 - 100 gr. Shu Dai Zi - Pu Er Fermenté Bio - 2011 - 100 gr. Pu Er Fermenté Dayi 8592 - 2012. Pu Er Brut Xiaguan Special Grade 2007 - 100 gr. Pu Er Brut Dayi 8582 - 2012. Pu Er Fermenté Dayi 8592 - 2011. Les thés de type Wul...
theschinois.com 3349620. The Schipani Group
The Fashion Industry's Leading Sales Trainer. Include leading men’s and. Women's fashion and beauty brands. See the video interview. With Frank Schipani, President and Founder of The Schipani Group. The New Book is Now Available. Frank's Rules How to Sell Menswear (and Practically Anything Else) Extremely Well. Provides a roadmap for being professionally prepared. whatever you do. The Art of the Sale. Change Your Look, Change Your Life. Past Perfect: A Brief History of Style in America.
theschipanigroup.com 3349621. Shad and Andrea
Tuesday, July 7, 2015. Fish, Train, and Presidents. We rode a train from Keystone to Hill City. It took a little over an hour, and we saw several animals. This is how Barrett rode most of the trip. I'm glad Lawson didn't mind. He laughed and laughed at himself. After we ate a German lunch, we went to Mount Rushmore. It was a very foggy dreary day. Lawson liked comparing his coins to the Presidents' faces. Posted by Andrea Schipke. Tuesday, July 07, 2015. Sunday, July 5, 2015. South Dakota part 2. Beside ...
theschipkes.blogspot.com 3349622. The Adventures of Matt and Rach
The Adventures of Matt and Rach. This is us. What follows will be a visual guide to our life, our adventures and capers, our thoughts and questions. Come with us on the adventure of a life time and be vicariously swept into the experience as it unfolds. Saturday, March 14, 2015. Friday, March 13, 2015. Friday, September 26, 2014. 3rd Annual visit to Meadows Maize. Hay wagon ride: very informative, but not nearly as exciting as Papa's at the Wisselbrooke farm. Practicing for the future. With the turn in w...
theschipperfamily.blogspot.com 3349623. The Schipper family takes flight - Our Blog
Check us out on:. The Schipper family takes flight. Minimalism and Tiny Houses. On Sunday I turned 30. I've had mixed feelings about it. My twenties brought marriage, children, a career, a house, and more. What could my thirties possibly have to offer me? In the end I am the only one who can give my children a happy mother who loves life" -Janene Wolsey Baadsgaard". So how can I give my kids a happy mother? Interested in joining me in that challenge, or maybe running 31 or more miles this month? We've cr...
theschipperfamilytakesflight.com 3349624. The Schipper Group - Unlocking Potential For Your Business Space
The Schipper Group - Unlocking Potential For Your Business Space. Unlocking Potential For Your Business Space. Real Estate Development in Akron, OH. To create and maximize real property value by delivering innovative real estate solutions customized to our clients' specific needs. The projects that we have developed and manage span each major real estate sector including Office, Medical, Retail, Multi-Family, Industrial and Land Development. 4217 State Rte. 43. Downtown Akron, OH. 388 South Main Street.
theschippergroup.com 3349625. Blog de TheSchipperke - Blog de TheSchipperke - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Bienvenue sur mon blog dédié aux Schipperkes! Mise à jour :. Un peu d'histoire sur le Schipperke. Le Schipperke est une race très ancienne. Abonne-toi à mon blog! Bonjour tout le monde et bienvenue sur ce blog dédié aux Schipperkes! Je pense que vous vous demandez ce qu'est un Schipperke, et bien c'est une race de que j'adore! C'est justement pour ça que j'ai fait ce blog, en plus j'en ai un chez moi, il s'appelle Figaro et c'est lui sur la photo! C'est un sp...
theschipperke.skyrock.com 3349626. The Schipperke | Everything about the Schipperke, a friend you will never forget!
Everything about the Schipperke, a friend you will never forget! A Dutch/English website about the original Belgian Schipperke dog…. Use the menu above to navigate through this site. Dit bericht is geplaatst op 17 juli 2015. Een reactie plaatsen. Blog op WordPress.com. Maak een gratis website of blog op WordPress.com.
theschipperke.wordpress.com 3349627. Oakville Real Estate | Home for Sale Oakville | Remax Oakville | Milton Real Estate
ABOUT MARY ANN SCHIRALLI. RE/MAX Aboutowne Realty Corp., Brokerage. Canada's Distinctive Women For 2013. Search For A Property. Mary Ann Schiralli Supports . Sold On A Cure. Oakville and Milton Humane Society. Mary Ann Will Obtain A Top Dollar Sale For Your Home. Helpful Tips For Selling. Need Help Buying Your Home? Helpful Tips For Buying. Find Your Dream Home. Real Estate Market Trends. RE/MAX Housing Market Outlook 2015. RE/MAX Aboutowne Realty Cares For SickKids. Shannon Ferguson, RE/MAX Select One.
theschiralliteam.com 3349628. The Schirard Wedding | Holly and Josh are getting married!
Holly and Josh are getting married! Sunday January 19th at 9:00pm CST. Click “Watch Live” in the menu above. On January 19th 2014 at 5:00pm (local time). Holly and Josh will be getting married on beautiful Wai’alea Beach in Oahu, Hawaii. Joining us in Hawaii? In the menu to see the full schedule of events while we’re in Oahu. Can’t make it to Hawaii? The wedding will also be broadcast live online via Ustream. As the date gets closer we will post a direct link to the broadcast here. Enter your comment here.
theschirardwedding.wordpress.com 3349629. Schires Family
Thursday, September 17, 2009. She did it. Sometimes she did it sick and should have been in bed. So she perked up once I repeated what Ive told her before. "You took care of me and Im gonna take care of You." My stuff at home can wait. Id rather be driving around the country side talking with her sipping cappuccinos. Rather than painting by myself any day of the week. Tuesday, September 15, 2009. We can party our way. BBQ chicken and ice tea! Monday, September 14, 2009. A Little About ME :). During down ...
theschires.blogspot.com 3349630. The Schires Five
Monday, June 15, 2015. Our Summer Bucket List}. Day Trip To New Ulm. Camping * Trip To Council Bluffs, Iowa. Trip To Eau Claire, Wisconsin * Jay Cooke State Park * Blue Mounds State Park. Nelson's Ice Cream * Fishing. Drive In Diner in Taylors Falls. Cup-N-Cone * Stairs In Stillwater. Chutes And Ladders Play Area. Drive In Movie * Duluth Day Trip. Explore The Mines In Grand Rapids *. Free Summer Movies At Muller. St Paul Farmers Marke. T * Shops At Maple Grove. Go Blueberry Picking *. Put Out Our Poo.
theschiresfive.blogspot.com 3349631. The Schirmers in La Serena | The Schirmers' adventures in Chile
The Schirmers in La Serena. The Schirmers' adventures in Chile. Protected: Outing with Hendrik’s jardin. This content is password protected. To view it please enter your password below:. This content is password protected. To view it please enter your password below:. We are finally approaching the end of this pregnancy. Yay! Other than the middle-of-the-night waking up, Hendrik is a happy boy these days. He started his new kindergarten in January, and all 3 of us love love love it! He still also loves o...
theschirmers.wordpress.com 3349632. The Schisgal Agency
The Schisgal Agency, LLC.
theschisgalagency.com 3349633. The Schismarch
Seems like a good day to GO KICK ASS! The Quest Of Our Dark, Tormented Souls. At 22, now, I think it's safe to say not a shit is given anymore. I think everyone has ran out of whatever willpower for self-introspection they ever were to have (unless they truly fuck up in which case they might. Bother to do some self analysis) and no one is really interested in being particularly understood. Oh and the world will never understand . But yeah. We might be interested in being seen as. Labels: 18 years old.
theschismarch.blogspot.com 3349634. The Schismatic Momentum
Atheist, humanist, thinker, and photoshop novice. March 16th, 2013 at 10:00PM. Steubenville Rape Suspects’ Text Messages Paint Very Disturbing Picture of Night Alleged Rape Occurred. TW: Graphic Descriptions of Rape and Sexual Assault, Explicit Content, Graphic Rape, Graphic Sexual Assault, Rape Culture, Rape Enablism, Rape Apologism]. Cut for length - click here to read the entire post. I’m serious. I can’t believe what I just read. February 28th, 2013 at 11:45PM. February 11th, 2013 at 9:07PM. With a m...
theschismaticmomentum.tumblr.com 3349635. The Schismatist
Dispatches from the Depths. Me and My Beliefs. Friday, June 17, 2011. I'm Still Here Crakkaz. It has been 178 days since I last wrote. I had my Close of Service conference last week. Processing the end, catharsis, etcetera. I'm leaving soon y'all. This grand journey called the Peace Corps is about to cough me up into the states. I plan to land like a loogie and slug around for a while. Actually. that makes a lot of sense. You may be asking yourself "Whaa? I thought you were going to law school? Now after...
theschismatist.blogspot.com 3349636. Find the best domain names to register
Register a Domain Name Who Owns This Domain? The domain name registration process for your businesses web site begins here. Register a great domain name with Verio from only $9.95 and receive a free 3 page website and email account. 1 Find Your Domain Name. 2 Choose Your Extensions. Enter up to 5 domain names. Couk ($38 for 2 years). Create the site you want with Verio hosting plan options. Verio is your strategic partner for top-tier hosting for complex websites and dedicated hosting.
theschisms.com 3349637. TheSchistoVac: the targeted development of a new generation vaccine for schistosomiasis
This project has received funding from the European Union’s Seventh Framework Programme for research, technological development and demonstration under grant agreement no 242107.
theschistovac.eu 3349638. Theschitt
theschitt.com 3349639. The Schitty
The Schitty. It is what it is. Saturday, November 20, 2010. Wednesday, May 12, 2010. San Francisco, New York's good-looking younger sister. People are always comparing SF to NYC. For the obvious reason - we're both densely populated urban destinations with rich colorful histories, and which continue to be places people know they can go to find adventure and opportunity. You can't really compare places like NYC and SF to places like LA, Vegas, Miami, Seattle, Chicago or Austin. A lot to compare.]. Just ge...
theschitty.blogspot.com 3349640. theschitzoyouknow (Bair) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) " class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ". Join DeviantArt for FREE. Forgot Password or Username? Deviant for 10 Years. This deviant's full pageview. Last Visit: 47 weeks ago. This is the place where you can personalize your profile! By moving, adding and personalizing widgets. Why," you ask? I imagine you...
theschitzoyouknow.deviantart.com 3349641. Home - The Schizo Chef
I offer corporate culinary classes (team building), public cooking classes, theme parties and private chef services. Contact me today for more information! Be adventurous and try a new dish tonight! Here you can find a full list of all my shared recipes complete with images and instructions. Join me for monthly classes and events designed to introduce food connoisseurs to multicultural dishes that are sure to please the palate! August 12, 2015. Vegetarian “Meatloaf” Muffins. August 12, 2015.
theschizochef.com 3349642. The Schizo Effect | my favorite color is no pants
My favorite color is no pants. Alicia Keys: Fallin [my cover]. June 3, 2015. By The Schizo Effect. I was coerced into participating in one of those “viral” challenges…. This is the result. LOL. I hope all my new creative blogging friends had a wonderful weekend! Yes…. I am a fool. Others ways to view:. April 16, 2015. By The Schizo Effect. My sense of humor. Fight for your life. The fight of my life. A battle for wellbeing. No view of the surface. A battle for mind, body, and soul. And it’s ok. During my...
theschizoeffect.com 3349643. THE SCHIZO EVENT | recidivism / retreat / redaction
theschizoevent.net 3349644. The Schizofreniks - Official Website
Follow us on social network. HTML Image Gallery by WOWSlider.com v2.0m. 26 million YouTube views for all videos. 280 000 Independent and Major record label sales. 1 act. Welcome to the phenomenom of 'The Schizofreniks'. About Us Current news and information on The Schizofreniks. Now is the time for The Schizofreniks to step out of the shadow. They will be touring the UK and abroad with DJing and live music performances so look out for them and join The Schizofreniks' journey ! What The Media Say.
theschizofreniks.com 3349645. Blog de theschizogirl - [[je ne suis qu'une enfant.Ce mOnstre que les adultes fabriquent avec leurs regrets...]] - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Je ne suis qu'une enfant.Ce mOnstre que les adultes fabriquent avec leurs regrets.]. Mise à jour :. Abonne-toi à mon blog! Sa y est , c'est la fin =]. N'oublie pas que les propos injurieux, racistes, etc. sont interdits par les conditions générales d'utilisation de Skyrock et que tu peux être identifié par ton adresse internet (67.219.144.114) si quelqu'un porte plainte. Ou poster avec :. Posté le lundi 26 février 2007 04:05. Poster sur mon blog.
theschizogirl.skyrock.com 3349646. Theschizoid.com
theschizoid.com 3349647. Solid ground from those out of this world
Solid ground from those out of this world. Most Recent Entries] [Calendar View]. Below are the 20. Most recent journal entries recorded in Schizoid Personality Disorder. Saturday, January 12th, 2013. Do you think I have a schizoid personality? Wednesday, December 28th, 2011. Christmas, family, and the like. I think I can honestly say, holidays annoy me at best, and make me sad at worst. Im married to an Italian man, and that really. Sometimes I wonder.what is it like to want. To be with your family?
theschizoid.livejournal.com 3349648. TheSchizoidhydra - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Deviant for 4 Years. Last Visit: 142 weeks ago. This deviant's activity is hidden. Deviant since Jul 14, 2012. This is the place where you can personalize your profile! Why," you ask? Apr 21, 2013.
theschizoidhydra.deviantart.com 3349649. Sonyoungbae.com
theschizoidman.com 3349650. theschizokid | Writer/Visual artist/BLues musician
Skip to primary content. Skip to secondary content. 8220;My Demons” This is my way of poking fun at my Schizo-Affective Illness. January 12, 2015. 8220;My Demons”. My demons, well many poets and writers wax poetic about facing their demons. I have been struggling with this as a person lately being on the tail end of really manic episode, I am faced with a brutal depressive phase, I can only describe as absolutely hellish. So, this is my little ode to my demons. Still, my demons. November 13, 2014. We hav...
theschizokid.wordpress.com 3349651. Welcome theschizophreniablog.com - BlueHost.com
Web Hosting - courtesy of www.bluehost.com.
theschizophreniablog.com 3349652. The Schizophreniad | A Carnival Cruise on the Ship of Fools, full of history, philosophy, commentary, poetry, and pop culture; let us look at life's lunatic myriads together
My Deviant Art Page. A Critical Analysis of Psychiatry as it is Practiced in America Today. July 9, 2015. The Definition of Disease. Psychiatry resides within the realm of medicine. Medical professionals try to make people healthy, which means the treatment of disease. Psychiatrists, by extension, treat the mental version of that, namely mental illness. How do we define disease; and how mental illness? A loss of functionality in the region affected, ie it is harmful. That many of these activities are har...
theschizophreniad.com 3349653. Beyond Survival: The Schizophrenia Myth
Neither doctors nor scientists can accurately predict who will become schizophrenic. The cause is largely unknown." - Newsweek, March 11, 2002. The media has done an excellent job of demonizing schizophrenics. So that when people look at my son, they don't see a human being.". Mrs Nash, Law and Order SVU, season 2 episode "Noncompliance". Beyond Survival: The Schizophrenia Myth. Why change the definition of schizophrenia? What is the role of schizophrenia in society? Is schizophrenia a brain disease?
theschizophreniamyth.com 3349654. Blog de theschizophreniclens - The Schizophrenic Lens - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Votre Lentilles Souffre de psychose? La Notre Aussi. Voyez Vous, elle est schyzophrène. Mais quoique . Voyez vous, Elle est dotée d'une remarquable capacité à memoriser les choses, les endroits, les petits coins ( Petit l'adjectif) . Choses qui ne lui passent pas sous l'Oeil! Blog photo Par Dark' et commenté par Junky :). Délires à Aimer . Mise à jour :. Abonne-toi à mon blog! Etre : Sens Dessus Dessous . L'Etes Vous? D'autres Se ressemblent tellement . N'oub...
theschizophreniclens.skyrock.com 3349655. The Schizophrenic Needle
Monday, March 25, 2013. Just finished 2 fitted chair and 2 sofa slip covers. Sheesh what a feat. It's done! Thursday, March 21, 2013. And the needle strikes back. I know it's been a while, since 2011 to be precise. My relationship with needles has not changed. Since my last blog post, I have purchased 2 new sewing machines, 1 antique singer and a tattoo machine. WHAT? Yes, you read that correctly, tattoo machine. Who knows, I might just become the next Kat Von D of kinnakeet. ). Friday, May 6, 2011.
theschizophrenicneedle.blogspot.com 3349656. The Schizophrenist - Reshma Valliappan
theschizophrenist.com 3349657. Ilene B. Benator: The Schizo Series
Ilene B. Benator. Hidden in Plain Sight. Available for Pre-Order Now! Hidden in Plain Sight. Available for Pre-Order Now! A laudable mystery that starts tangled and slowly unravels with not one but two twists at the end.". Cinematic Book Trailer for Schizo: Hidden in Plain Sight. Highly recommended not just for thriller readers; but any who wanted One Flew Over the Cuckoo’s Nest to take the next step. ”. Mdash; Diane Donovan,. Schizo: Hidden in Plain Sight. Schizo: Hidden in Plain Sight. Read the first c...
theschizoseries.com 3349658. The Schizzle
TheSchizzle.com is merely a holding page for an email address, so if you were hoping to find me here - I'm sorry. I'm a 'Jill-of-all-trades' you see, so I flitter about from here to there and am very hard to pin down to any one spot! Just for fun, I like to play with web design. It keeps me stress-free, you see! If you're interested in having a simple 'blog' designed (or a template tweaked) you can get hold of me by phoning 07 571 5286. Is there a catch? Yep find out what it is here. Have a lovely day!
theschizzle.com 3349659. Straight To The Legend | The Schkoots
Straight To The Legend. Includes unlimited streaming via the free Bandcamp app, plus high-quality download in MP3, FLAC and more. 01-THE SCHKOOTS Sexy Mais Monogame. 02-THE SCHKOOTS Pense Kassa. 04-THE SCHKOOTS Je M Mouille. 05-THE SCHKOOTS Love Me Twice. 07-THE SCHKOOTS La Rebellion. 08-THE SCHKOOTS J attend Dement. 09-THE SCHKOOTS No Fun. 10-THE SCHKOOTS J Travaille A La Mine. 11-THE SCHKOOTS Hide Away. 12-THE SCHKOOTS Watching TV. 13-THE SCHKOOTS Legend of R&R. Released February 4, 2016.
theschkoots.bandcamp.com 3349660. David & Laura's Gallery
54 photos in 1 sub-album. 284 photos in 10 sub-albums. 348 photos in 8 sub-albums. 354 photos in 19 sub-albums. 401 photos in 17 sub-albums. 702 photos in 14 sub-albums. 821 photos in 14 sub-albums. 517 photos in 7 sub-albums.
theschlabachfamily.com 3349661. › Log In
Larr; Back to.
theschlagenhafts.com 3349662. Business profile for theschlagers.net provided by Network Solutions
Phone: Your business phone number. Fax: Your business fax number. Email: Your business e-mail address. The type of business you are in. Your list of brands. Products and/or services you provide. Coupons and other discount information you offer. Any other information about your business. Your hours of operation. Methods of payment you accept. If this is your Web site, you can customize your business profile from your account at Network Solutions. To edit your business profile.
theschlagers.net 3349663. THE SCHLAGER SYSTEMS
WECLOME TO THE SCHLAGER SYSTEMS BLOG. THIS SITE IS RUN BY SCOTTISH GLAM OUTFIT 'THE VODKA SYSTEMS' AND EXPLORES OUR LOVE FOR SCANDINAVIAN SCHLAGER! WE HOP OVER TO SWEDEN FREQUENTLY TO SEE OUR FAVE SCHLAGER STARS PLAY! WE LOVE CAROLA, ANNA BOOK, KIKKI, LINDA BENGTZING, LENA PH, MAGNUS CARLSSON, SANNA NIELSEN, ABBA.TO NAME BUT A FEW. STAY TUNED TO FIND OUT WHAT FUN AND HIGH JINKS WE GET UP TO! TO SCHLAGER AND BEYOND. Sunday, 25 April 2010. Friday, 20 February 2009. TSS: Does Marina wear a fabulous frock?
theschlagersystems.blogspot.com 3349664. AG World Missions / Home
Make a church web site.
theschlaks.com 3349665. 失敗しない太陽光発電
theschlalalas.com 3349666. The Schlater Family
Saturday, June 21, 2008. Lexi's First Day of School. Thursday, June 19, 2008. Sunday, May 18, 2008. Liams run in with a "Dinosaur". Liam and Lexi's New Toy. Thursday, April 17, 2008. Lexi's 1st Pony Tail! What a beautiful day we had today! It was 75 and Sunny! We played in the park, went to Rita's Water ice and played on the deck! Cousins night March 08! John, Liam, Lexi, Lora, Mandy, Joey, Heather, Charlie, Rebecca and baby Erwin had a wonderful dinner at Heathers! Happy Easter.Part 3.
theschlaters.blogspot.com 3349667. Marc & Susan Schlather
Coming Soon: Stay tuned.
theschlathers.com 3349668. Lights to a Beat - Home
Lights to a Beat. Holiday Lights to Music. The lights will be on through Sunday, January 4th. Sunday through Thursday: 5-10pm. Friday and Saturday: 5-10:30pm. Follow us on Facebook and Instagram for the latest information (links above). This year we are accepting donations for the Memorial Sloan Kettering Cancer Center. Click the button below to make a tax deductible donation. Our 2014 playlist includes:. Shake it Off - Taylor Swift. All About That Bass - Meghan Trainor. Feliz Navidad - Jose Feliciano.
theschlatters.com 3349669. The Schlaud's
Monday, August 10, 2015. Last week we went to Port Sanilac with the Perlin clan. Nicholas played in the sand, swam in the lake and had lots of fun with his cousins. There was also a big storm that resulted in power loss for about 24 hours. We survived by going raspberry picking, strolling around town, grilling, and playing at the park. Helping daddy pack the cooler. Hanging out in the boat with his cousins. Checking out the little fire on the deck. Monday, July 27, 2015. On Sunday, I took Nicholas to the...
theschlauds.blogspot.com 3349670. Index of /
theschlauf-wp.com