1417824. Westtelecom
Central do Assinante Gerenciador de Conta. Fixo: (17) 3211-8080 (08:00 as 18:00). 0800: 0800 773-1514 (08:00 as 22:00). Vivo (17) 99619-5007 Oi (17) 99809-1810. Claro (17) 99223-4951 Tim (17) 98172-2875. Westtelecom: Rua XV de Novembro, 3171 2º andar sala 21. Centro São José do Rio Preto - SP, 15015-110.
westtelecom.com.br 1417825. West Telecom
Domingo à Domingo das 08:00 às 21:00h. Sujeito a viabilidade técnica. Regulamento SCM / ANATEL.
westtelecom.net 1417826. WESTTELECOM INTERNET LTDA
Sábado, 15/08/2015 - 04:01. Raquo; Página principal. 841 DE FEVEREIRO DE 2012. Conteúdo página principal. CENTRAL DO CLIENTE 24 HORAS. CENTRAL DE ATENDIMENTO AO CLIENTE. 48) 4052-9163 ou 8441-3143. HORÁRIO DE ATENDIMENTO DE SEGUNDA A SEXTA. 09:00hrs as 12:00hrs - 13:30hrs as 18:00hrs. SABADO DAS 09:00 as 12:00. CENTRAL DE ATENDIMENTO AO CLIENTE. Suporte Técnico: (48) 4052-9163 ou 8441-3143. HORÁRIO DE SUPORTE TÉCNICO DE SEGUNDA A SEXTA. 09:00hrs as 12:00hrs - 13:00hrs as 17:30hrs. 07 de Abril / 2014.
westtelecom.net.br 1417827. westtelecommunications.com
westtelecommunications.com 1417828. westtell.com
Inquire about this domain.
westtell.com 1417829. Account Suspended
This Account Has Been Suspended.
westtemple.com 1417830. Account Suspended
This Account Has Been Suspended.
westtemple.org 1417831. Temple Bound
Monday, September 5, 2011. Road Trip = 2 More Temples! Two weeks a go Heath and I got to take our summer trip! The main reason we went on it was to go down to Mesa, AZ for Aaron and Aubrie Butler's wedding but we made a whole road trip out of it and it was so wonderful! We'll post all about our trip on our other blog but here are our experiences in two more temples! Our trip went from Wednesday night until Tuesday night. So fun! It was crazy but so pretty! He a good catch? Because my Dad served there any...
westtemplejourney.blogspot.com 1417832. West Temple Life
Joy, sorrow, stillbirth, strength, family, friendship, life. Remembering Kai. photos. Books, Links, etc. Sunday, February 17, 2013. Annual IL Holiday exchange. Every year since my son was stillborn I have participated in a Holiday Gift Exchange for Infant Loss parents. This year I had the privilege to make a gift for Holly's daughter, Eden. I had made a basket full of cast pulp hearts and stars because I was also hosting some fellow IL moms at my studio for a holiday ornament making session. Because I ke...
westtemplelife.blogspot.com 1417833. AT&T Website Solutions
This site is under construction or otherwise unavailable. Please check back later. Hosting is provided by AT&T Website Solutions. AT&T does not own this domain name. To learn about hosting products and services provided by AT&T, please visit us at http:/ webhosting.att.com. 2014 AT&T Intellectual Property.
westtemplemedical.biz 1417834. West Temple Orthodontics - Home
Caring for your Braces. Smile More. Get Braces! Julie E. Sieh DDS, and Larrissa Cali DMD, MSD invite you to experience state of the art orthodontic care at their practice, West Temple Orthodontics. We offer orthodontics to children, teens, and adults. We are committed to providing each patient outstanding treatment in a fun and friendly environment. Our goal is to deliver smiles that last a lifetime. Call us today to set up your free consultation. The doctors at West Temple Orthodontics regularly work wi...
westtempleorthodontics.com 1417835. West Temple Storage – Your Salt Lake City Self Storage Solution
Your Salt Lake City Self Storage Solution. The Perfect Solution to meet your Salt Lake City Self Storage Needs! West Temple Storage is conveniently located off of West Temple Street in Salt Lake City Utah just east of Cafe Jose and Calligraphy by … Continue reading. West Temple Storage offers exceptional value for your money. Our storage units are HUGE and our prices are small! The average price per square … Continue Reading. West Temple Self Storage. 3477 South West Temple. Salt Lake City, UT 84115.
westtemplestorage.com 1417836. Overview | West Ten
Skip to main content. West Ten is a premier master-planned business park located on Interstate 10 and Highway 90 in Katy, Texas. West Ten’s 470 acres will provide occupants with unparalleled access to community amenities, a major transportation corridor, visibility, a high-quality employee base and close proximity to Houston’s Energy Corridor. West Ten’s planning reflects a desire to maximize values and promote a long-term real estate solution for the tenants in the park. West Ten Master Plan.
westten.com 1417837. West Ten Motorsport | Drag Racing Team
Shelley Pearson is the UK’s fastest female racer. Pearson rocked the European Drag Racing world in 2010 with a record licensing run of just 4.98 seconds, at an incredible 278 mph. Having achieved her license in style, she will now contest the pinnacle class in European Drag Racing – 8,000BHP, 300 MPH Top Fuel Dragster. And when you consider that these short wheelbase vehicles can produce 4 second 1/4 mile times with speeds over 300MPH these are not for the feint hearted! Just done a 5 second run!
westtenmotorsport.com 1417838. West Tennessee Express
Your SEO optimized title. Reasons to Drive with Us. Reasons to Drive with Us. Truck driver jobs in West Tennessee West Tennessee Express. Truck driver jobs in West Tennessee. Family oriented company offering Regional, Short Haul, and Local services. Reasons TO drive WITH us. More reasons to drive for us. Join our family of drivers. We are a family oriented company. Ohio, Michigan, Indiana, Illinois and return. 350 mile radius of Jackson, TN. Familiar territory - Consistent freight. 731) 424-9791 EXT 205.
westtenn.com 1417839. West Tenn Auto Buff Club
West Tenn Auto Buff Club. MEET * GREET * and * COMPETE *. WEST TENN AUTO BUFF CLUB. 125 Cheyenne Dr Jackson Tenn. 100;etonatoryellow@live.com. 160;      W.T.A.B.C. 160;     WELCOME. 160;    . 160;   ". 160;                ". West Tenn Auto Buff Clubs First Show HOT SUMMER RODS INFO. 160; Location North Park Jackson Tenn 2.pm. June 13th Bring the Family! OTHER CAR CLUBS SHOWS/SITES. Jackson Tennessee Madison County Attractions. Mdash;——. Mdash;——. KEEPING ARE HEADS ABOUT THE HIGH WATER. Http:/ www.bin...
westtennautobluffclub.webnode.com 1417840. West Tenn Bullies - American Bulldogs - Breeder in Tennessee
Welcome to West Tenn Bullies. We started with our first bulldog in 2003. We like a bully type American Bulldog. We like our dogs to have heavy muscle mass and bone with a wide chest and a nice blocky head. Our goal is plain and simple: To produce only the best. Peggy and David Bromley. All articles, photos, and information on the site are SOLE property of West Tenn Bullies. And cannot be copied, distributed or LINKED to any other website, newsletter or.
westtennbullies.com 1417841. 404 Page Not Found
We cannot locate the page you're looking for. Please check the address and make sure all letters are lowercased with no spaces.
westtenncarpetcleaning.com 1417842. MidSouthCriminalLaw.com - Criminal Defense, Probation/Parole, and DUI/DWI Defense
Law Office of Wendell L. Hoskins II. We are attorneys defending clients in the state and federal courts of Arkansas, Missouri and Tennessee in criminal matters, including:. DUI/DWI and inaccurate field sobriety testing;. Assault and battery;. Drug possession, manufacturing and distribution;. Illegal search and seizure of contraband;. Our mailing address is:. Post Office Box 1115. Caruthersville, Missouri 63830. For overnight delivery, use:. Caruthersville, Missouri 63830. Wendell L. Hoskins II. Is a grad...
westtenndui.com 1417843. Confessions of a West Tennessee Liberal...
Confessions of a West Tennessee Liberal. Politics, righteous indignation, and random giddiness about my upcoming daughter. Wednesday, November 05, 2014. Here's why I'm not that upset about the 2014 election results. All over television, pundits and talking heads are going on about what last night meant. Don't listen to about 95% of it. They need ratings, and they have to come up with a false narrative in order to keep the audience captivated. To further emphasize my point. Look at these two graphs:.
westtennessee.blogspot.com 1417844. Secure Redirect
westtennesseeappraiser.biz 1417845. Secure Redirect
westtennesseeappraiser.com 1417846. AT&T Website Solutions
This site is under construction or otherwise unavailable. Please check back later. Hosting is provided by AT&T Web Solutions. AT&T does not own this domain name. To learn about hosting products and services provided by AT&T, please visit us at http:/ webhosting.att.com. 2012 AT&T Intellectual Property.
westtennesseeareahealtheducationcenter.com 1417847. Assisted Living Dyersburg, TN - Canterbury Place
Dyersburg, TN Assisted Living. Canterbury Place of Dyersburg, TN is a licensed assisted living facility that offers excellent residential care to its clients. Our quality service at affordable rates guarantees satisfaction. Our rooms are private and spacious, and are equipped with a private bath, a closet, and individual climate controls. We even offer regular activity programs that include community events, cultural outings, and shopping excursions. Learn more about Canterbury Place:. Dyersburg, TN 38024.
westtennesseeassistedliving.com 1417848. West Tennessee Basket Guild -
West Tennessee Basket Guild. What Are the Benefits of Using a Taxi Cab Service. What Are the Benefits of Using a Taxi Cab Service. If passengers request multiple stops, the flat rate of $400 will be collected at the first stop in either Manhattan or John F. Kennedy Airport, and the meter will be turned on for the remainder of the trip. The metered fare should be collected at the last stop, from the last passenger. Taxis are cash only. What if you have a judgment against a taxicab company or a taxi driver?
westtennesseebasketguild.com 1417849. West Tennessee Bujinkan - Home
Welcome to the West Tennessee Bujinkan We train in Bujinkan Budo. Taijutsu as taught by Grandmaster Masaaki Hatsumi. This site is for anyone. Interested to lean basic information about our classes and the Bujinkan. We. Train twice a week on Tuesday and Thursday nights from 7:00 - 8:30 at the Fight Shop. Fight Shop is located at 2604 Bells Highway , Jackson Tennessee 38305. Our practices include Taihenjutsu. Methods of rolling , falling, footwork, and body positioning skills ). At West Tennessee Bujinkan.
westtennesseebujinkan.weebly.com 1417850. West Tennessee Workforce Development Board — Putting West Tennessee to Work!
Incumbent Worker Training Grants. Work Opportunity Tax Credit. Looking for a Job? Start Your Job Search NOW! Career Readiness Cert (CRC). SCSEP – Older Worker Program. Southwest Human Res. Agency. August 15, 2015. West Tennessee Workforce Development Board. Putting West Tennessee to Work! Dads Graduate Fatherhood Pilot Program in McNairy Co. Jail, Selmer, TN. WIOA Notices of Proposed Rulemaking Released. RFP Released: Economic Study for West Tennessee. TDOL Career Coach comes to Lexington. TDOL Career Co...
westtennesseecareers.org 1417851. westtennesseecares.com
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
westtennesseecares.com 1417852. Chiropractor Dyersburg, TN - Lusk Chiropractic Health Center
Dyersburg, TN Chiropractor. Lusk Chiropractic Health Center. Lusk Chiropractic Health Center is a team of dedicated chiropractors serving the Dyersburg, TN area. In business since 1996, we provide professional chiropractic care for all ages. Our specialties include acupressure, myofascial massage therapy, nutritional counseling, and physiotherapy. Lusk Chiropractic Health Center is your partner in complete chiropractic treatments! Adjustment and manipulation of the spine and extremities.
westtennesseechiropractor.com 1417853. Welcome westtennesseecommunities.com - BlueHost.com
Web Hosting - courtesy of www.bluehost.com.
westtennesseecommunities.com 1417854. Birdsong Resort, Marina, RV & Tent Campgrounds
Online since 1993 with over 150,089,128 unique visitors and literally. Billions upon billions of hits to this site.for this we say "THANK YOU". And please come back often as our site changes daily. Birdsong Resort, Marina and Campground on beautiful Kentucky Lake,a Tennessee Resort in Camden, Tennessee, features fishing, cottages, campground, boat rentals, marina, boat sales and service, Freshwater Pearl Farm, museum, jewelry showroom and a Pearl of a Tour.
westtennesseecvb.com 1417855. West Tennessee Disaster Relief 2010 | Just another WordPress.com site
West Tennessee Disaster Relief 2010. Just another WordPress.com site. Roy Herron Release’s West Tennessee Resource List. May 5, 2010. Roy Herron for the Win. Benton County Chapter, Camden, Phone: 901-584-6333. Clarksville – Montgomery County Chapter, Clarksville. Http:/ clarksville.redcross.org. Dyer County Chapter, Dyersburg. Jackson Area Chapter, Jackson. Mid-South Chapter, Memphis. Nashville Area Chapter, Nashville. Obion County Chapter, Union City, Phone: (731) 885-5113. Tennessee Emergency Managemen...
westtennesseedisaster2010.wordpress.com 1417856. Index of /
westtennesseefamilywalkinclinics.com 1417857. Furniture Dealer Dyersburg - General Appliance and Furniture Co.
Dyersburg, TN Furniture Dealer. General Appliance and Furniture Co. General Appliance and Furniture Co. is a dealer of quality home furniture, appliances, and electronics in Dyersburg, TN. We have been in the business since 1947. Our experienced sales associates have the knowledge and expertise that you need to create an attractive and comfortable home. Carpet / area rugs. Home accents / home accessories / art / mirrors. Electronics-TV / DVD / home theater. Upholstered furniture / slip covers.
westtennesseefurniture.com 1417858. West Tennessee GCA
GCA FUN AND FITNESS THROUGH TUMBLING AND TRAMPOLINE! HIGH SCHOOL AND MIDDLE SCHOOL CHEER CAMPS and CLINIC BEGIN JUNE 1ST! GCA IS HOME TO. GCA NATIONAL CHEERLEADING SQUADS! Welcome to West Tennessee GCA. GCA HAS 5 BRANCH LOCATIONS THROUGHOUT WEST TENNESSEE! HENDERSON AND CAMDEN ON MONDAYS. MCKENZIE ON TUESDAYS, ALAMO ON WEDNESDAYS, AND MILAN AREA ON THURDAYS. GCA LEXINGTON IS OUR MAIN GYM AND IS OPEN 7 DAYS A WEEK. OUR NEWEST TUMBLE LOCATION: ALAMO! We provide a FUN. GCA ELITE SENIOR and YOUTH ALLSTARS!
westtennesseegca.com 1417859. Real Estate in Milan | Buy and Sell with Frances Wadley
Real Estate in Milan. Buy and Sell with Frances Wadley. Learn more about Frances. Learn more about Milan. Find a home in Milan. Find out how much you can afford. Residential / Single Family. LA Realty, LLC. Let me do the work for you! My name is Frances Wadley and I have been a Realtor since 1981. I love clients and enjoy helping them to meet their needs and wants. Everything you need to know about buying or selling a home can be found here on my Web site! Http:/ www.franceswadley.com/. LA Realty, LLC.
westtennesseehomesales.com 1417860. West Tennessee Hotrods | We Buy, Sell, or Trade and also have salvage.
Hotrod Restoration – 2008.
westtennesseehotrods.com 1417861. Real Estate
Find the Perfect Property. Find Your Home's Value. Welcome to my web site. I’ve gathered a wealth of information here to help you with all of your real estate needs – from all the latest property listings to great information for both home buyers and sellers. Search for property by entering an Address, Street, City, County, Zip Code, or Listing ID below. Home Improvement Rules: Adding a 3rd Bathroom? Home Improvement Rules to help you get the most value when selling your home. Adding a 3rd Bathroom?
westtennesseelandforsale.com 1417862. West Tennessee Law: Eric P. Egbert Attorney at Law
Darr; Skip to Main Content. 104 North Central Avenue Humboldt, TN 38343 (731) 388-9378 eric@westtennesseelaw.com. Contract Law & Debt Collection. Estate Planning & Elder Care. Family & Divorce. If you would like a consultation, please complete the application to get started today. Eric P. Egbert. 104 North Central Avenue. Humboldt, TN 38343. Medina, TN 38355. 2015 West Tennessee Law: Eric P. Egbert Attorney at Law.
westtennesseelaw.com 1417863. Tennessee Attorneys Offer You Help With Free Downloads - Newman & Webb
James “Jimbo” Webb. About our Law Firm. Learn more about Brandon Newman, James "Jimbo" Webb and our approach to providing exceptional legal assistance. Receive a FREE consultation to learn more about your legal needs. What Newman and Webb Promise You. Prehistoric Relationships: A Precursor to Marriage. June 18, 2014. 5 Reasons to Visit Gibson County Downtowns. Reasons to visit Gibson County Downtowns As Gibson County Lawyers, we are proud to have our homes and business in a county that has so many cultur...
westtennesseelawfirm.com 1417864. Welcome to WESTTENNESSEEMLS.COM
This page is provided courtesy of GoDaddy.com, LLC.
westtennesseemls.com 1417865. www.westtennesseemotor.com
This Web page parked FREE courtesy of Domains Priced Right. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $4.99/mo. Call us any time day or night (480) 624-2500.
westtennesseemotor.com 1417866. West Tennessee Motor Coach
Thanks so much for carrying us to St. Louis and back home safely. You were very accommodating and we all appreciate it. Hope you enjoyed yourself as well. Best Regards, Russell T. Clarkson, Central Distributors, Inc. Paris, TN 38242. West Tennessee Motor Coach, LLC. Sports Travel, School Trips, Family Reunions, Church Outings and more. WE ALSO OFFER FULL SERVICE TOUR PLANNING and EVENT PLANNING! Click to learn more about each service.
westtennesseemotorcoach.com 1417867. www.westtennesseemotors.com
This Web page parked FREE courtesy of Domains Priced Right. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $4.99/mo. Call us any time day or night (480) 624-2500.
westtennesseemotors.com 1417868. West Tennessee Moving & Storage, Paris, Tenn.
All Inclusive and Guaranteed. We don't believe in hidden surprises, so you know exactly what you're paying with no unexpected charges at the end of moving day. Request A Free Estimate. Superior Moving Services By Seasoned Movers. Family-owned and -operated, our company has built a proven reputation in the West Tennessee area that continues to spread throughout the region. Learn More About Us. Read our reviews and see what our customers are saying about us. Send to a friend. Your text message was sent.
westtennesseemovers.com 1417869. Home
West Tennessee Offroad is a family friendly off-road club in the greater Jackson, TN area. We love to go wheeling! There will probably be other youngsters there for them to play with! See you on the trails! Dyersburg, TN 38024. Henderson, NV 89011. 3539 Highway 412 E. Parsons, TN 38363. Tyler French - Manager. Jackson, TN 38305. Jonathan Towles - Manager. 4035 Austin Peay Hwy. Memphis, TN 38128. 2489 Highway 45 S. Jackson, TN 38301. We love to go wheeling! Check out our public Facebook page here.
westtennesseeoffroad.com