We are air fresheners manufacturer for Car and Home. Air Fresheners eliminate odors such as smoke, pet smells and more. We deliver high quality fragrances.
http://www.airfresh24.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.6 seconds
OPTIMAL Dariusz Jackiewicz
Dariusz Jackiewicz
Mikol●●●●●eja 3
Gd●●sk , pomorskie, 80-404
PL
View this contact
OPTIMAL Dariusz Jackiewicz
Dariusz Jackiewicz
Mikol●●●●●eja 3
Gd●●sk , pomorskie, 80-404
PL
View this contact
OPTIMAL Dariusz Jackiewicz
Dariusz Jackiewicz
Mikol●●●●●eja 3
Gd●●sk , pomorskie, 80-404
PL
View this contact
BUY YOUR DOMAIN
14
YEARS
9
MONTHS
6
DAYS
NETART REGISTRAR SP. Z O.O.
WHOIS : whois.netart-registrar.com
REFERRED : http://www.netart-registrar.com
PAGES IN
THIS WEBSITE
10
SSL
EXTERNAL LINKS
8
SITE IP
67.20.106.207
LOAD TIME
1.609 sec
SCORE
6.2
Air aroma - Natural air freshener manufacturer - Airfresh24 | airfresh24.com Reviews
https://airfresh24.com
We are air fresheners manufacturer for Car and Home. Air Fresheners eliminate odors such as smoke, pet smells and more. We deliver high quality fragrances.
airfresh24.com
Personalized air freshener - Private Label - Airfresh24
https://airfresh24.com/private-label
48 71 387 85 33. Elix as a flexible and innovative manufacturer offers possibility to develop private label air fresheners. Personalized air fresheners are tailor-made to meet all our Clients’ expectations, vision and design. They are also a great opportunity to balance all cost-driving factors in an offer. In ELiX Headquarters in our factory in Wrocław (Poland, Europe) we manufacture a wide range of air fresheners that include car air fresheners, home air fresheners, odor neutralizers. Sales and Project...
Company - Airfresh24 - air freshner manufacturer
https://airfresh24.com/company
48 71 387 85 33. We are air fresheners manufacturer. ELiX Corporate Group has specialized in manufacturing of air fresheners. Founded in 1999, has grown into a global supplier of high quality air freshening products. ELiX’s headquarters and main production facilities are in Wroclaw, Poland. To meet needs of Indian market, in 2015 we started up a JV: ELiX India Ltd. in Delhi region and began manufacturing an air fresheners designed especially for Indian OEM customers. MSDS available) and ISO 9001. We cons...
Become distributor - Airfresh24 - air freshner manufacturer
https://airfresh24.com/become-distributor
48 71 387 85 33. Phone: 48 71 387 85 33. Fax: 48 71 722 29 68. How can we assist you? How can we assist you? We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.
News - Airfresh24 - air freshner manufacturer
https://airfresh24.com/news
48 71 387 85 33. New trends in air fresheners! Get ready to real refreshment! Want to know what are the new trends in air fresheners? We are constantly introducing new products so we needed to create an insert with the latest ones. Check out some new pages of our catalogue and find out about product premiers in 2017. All products are already available to order. 2017 NF new products. Nanotechnology in cellulose air fresheners? How to make paper air fresheners to last longer? Shortening the distance, enhan...
Odor neutralizer manufacturer - Power air freshner - Airfresh24
https://airfresh24.com/products-category/odor-neutralizers
48 71 387 85 33. C&H Air Perfume with Neutralizer. ODOR BLOCK & FRESH Organic CAT. ODOR BLOCK carbon box: CAT. ODOR BLOCK carbon sachet: CAT. ODOR BLOCK carbon sachet: DOG. ODOR BLOCK & FRESH: CAT 300 ml. ODOR BLOCK & fresh DOG 300ml. ODOR BLOCK carbon box REFRIGERATOR. Natural Fresh Odor Block is the green solution for car and home odor control that has never been easier. Use our odor neutralizer, safe for food and very effective. Enjoy your fresh air aroma at home. Phone: 48 71 387 85 33. We use cookie...
TOTAL PAGES IN THIS WEBSITE
10
AirFresh - Producent Zapachów Samochodowych
41 373 23 10. 48 515 268 548. Szeroka oferta zapachów do samochodu. Oferujemy zapachy w płynie, naszyjniki oraz zawieszki zapachowe. Nasze produkty oferujemy szerokiemu gronu konsumentów, dzięki utrzymywaniu atrakcyjnej i korzystnej relacji pomiędzy ceną i jakością. Dowiedz się więcej o firmie AirFresh. Celem naszej firmy jest jej dynamiczny rozwój. Stale dążymy do tego, aby nasza marka stała się rozpoznawalna. Zapraszamy wszystkich zainteresowanych współpracą. Jesteś zainteresowany współpracą z nami?
Кондиционеры в Москве - проектирование, профессиональный монтаж и обслуживание систем кондиционирования и вентиляции.
Мультизональные VRV и VRF системы. Заявка на подбор оборудования. Олимпийская чемпионка Ирина Привалова. Я довольна качеством услуг.Компания ЕвроХолод проявила себя как ответственная надежная компания, и я могу смело рекомендовать ее самым взыскательным клиентам. И ещё 25 отзывов . Laquo;ЕвроХолод» - профессиональная климатическая компания в Москве. Монтаж промышленных систем кондиционерования и вентиляции. Сервисное обслуживание промышленных кондиционеров и систем вентиляции. Установка систем кондициони...
Colorwind Stationery
Colorwind Stationery is specializing in the production of various student and office stationery, such as ball point pen, mechanical pencil, marker,. Toy stamp, ink pad,. Sharpener, stapler, punch,. Correction tape, tape dispenser, ruler, e. Ser, glue, diaries, notebook, stick note, memo, envelope, card, file. If you need Chinese stationery with high quality, on time delivery, excellent service, please do not hesitate to contact us. Http:/ www.colorwind.com.cn. View Our Selling Leads. No of R&D Staff:.
The Air Fresh Blog | …..is currently writing on bounce sheets
The Air Fresh Blog. 8230;is currently writing on bounce sheets. I have a new blog! On June 7, 2010 by kjmusiconline. My Album…KJ – The Headphone. On April 6, 2010 by kjmusiconline. Whats up, heres a free copy of my album for those who still check my blog,. Thank you all…. If you like it, you can purchase on itunes or bandcamp. Links at the bottom. Http:/ www.sendspace.com/file/mo5svu. Http:/ www.airfreshk.bandcamp.com. Http:/ itunes.apple.com/us/album/the-headphone/id352255517. They have this at Target?
项目网—招商加盟项目信息网
Air aroma - Natural air freshener manufacturer - Airfresh24
48 71 387 85 33. The best made in Poland. Air fresheners how to use:. Live Fresh and Smile our motto on solving unexpected daily life situations. Good air freshener may calm you down making it easier to take decision. Just watch our short explanation how to smile 😊. Mailing promo code: NF201703airfresh24.com. We are air fresheners manufacturer. We specialize in air fresheners and odor neutralizers. Live Fresh and Smile. Phone: 48 71 387 85 33. Fax: 48 71 722 29 68. How can we assist you? We use cookies ...
Whole House Fan Reviews For Vacuums, Purifiers, Air Conditoners, And Many More
Whole House Fan Reviews Information. Re you getting the best possible quality air from within your home? Do you feel sometimes the symptoms of bad air quality, such as watery eyes, runny nose, coughing, and sneezing. Let's face it like me you take your air for granted. It's real easy to do and without whole house air cleaners you are probably breathing in unnecessary dust particles in your home. Will dictate the quality of our oxygen. . Whole House Fan Reviews Agencies. Whole House Fan Reviews Uncovered.
Air Fresh Dri Carpet and Upholstery Cleani
Carpet and Upholstery Cleaning. 208) 939-8600 mycarpet@airfreshcarpet.com. Boise * Meridian * Eagle * Nampa * Star. 7 Days a Week. Safe for Kids & Pets. Steam and Shampoo May Ruin Your Carpet. Causing Shrinking * Mildew * Seam Separation. Dries in 1 - 2 Hours. Leaves No Sticky Residue. Pet Stains and Odor Removal. Family owned and Operated over 30 years. Carpet and Fabric Protectors. Pick up and Delivery. Oriental and Wool Rugs. Commercial rates and Free Estimates. Our Prices Will Bring You In.
Chem-Dry Carpet Cleaning by Air Fresh Chem-Dry
Help Us Fight Breast Cancer. Chem-Dry Carpet Cleaning vs. Steam Carpet Cleaners. Power of Carbonated Cleaners. Pet Urine Odor Removal. Removing Stains on Carpets, Area Rugs & Furniture. Tile & Grout Cleaning. Natural Stone Cleaning & Polishing. Area Rug Cleaning & Oriental Rug Care Services. Auto, Boat, Plane & RV Carpet, Upholstery & Interior Cleaning. Dust Mite & Anti-Allergen. The Property Management Cleaner. What to Expect from Air Fresh Chem-Dry. Furniture & Partition Cleaning. Wool Carpet Care Tips.
airfreshchemdrycarpetcleaning.wordpress.com
airfreshchemdrycarpetcleaning | Just another WordPress.com site
Just another WordPress.com site. April 8, 2011. Welcome to WordPress.com. After you read this, you should delete and write your own post, with a new title above. Or hit Add New. On the left (of the admin dashboard. To start a fresh post. Are some suggestions for your first post. You can find new ideas for what to blog about by reading the Daily Post. To your browser. It creates a new blog post for you about any interesting page you read on the web. Make some changes to this page. The Twenty Ten Theme.
Airfresh Climatización, S.L.
En acondicionar tu vida. 2011 AIRFRESH CLIMATIZACION S.L., Pol. Ind. Boadilla de Arriba, nave 21 45200 - ILLESCAS - TOLEDO. CPD Banco de España,. Puesta en marcha y terminación de trabajos. MUTUA MADRILEÑAN - C/ Almagro, 40 Madrid -. Climatizadores de expansión directa DAIKIN. Parque de bolas - Señorío de Illescas - sistemas split industrial DAIKIN. Gimnasio Señorío de Illescas - sistemas centralizados DAIKIN. CPS Getafe - puesta en marcha con sistemas vrv DAIKIN. Comienzo de instalaciones VRV DAIKIN.
SOCIAL ENGAGEMENT