ALABAMATRAIL.ORG
Hiking AlabamaThis page uses frames, but your browser doesn't support them.
http://www.alabamatrail.org/
This page uses frames, but your browser doesn't support them.
http://www.alabamatrail.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
0.4 seconds
16x16
32x32
Not Applicable
M. Lee Van Horn
2801●●●●k St
Col●●●bia , SC, 29201
US
View this contact
Not Applicable
M. Lee Van Horn
2801●●●●k St
Col●●●bia , SC, 29201
US
View this contact
Not Applicable
M. Lee Van Horn
2801●●●●k St
Col●●●bia , SC, 29201
US
View this contact
Cloud Group Limited (R123-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
70
SITE IP
64.90.48.12
LOAD TIME
0.392 sec
SCORE
6.2
Hiking Alabama | alabamatrail.org Reviews
https://alabamatrail.org
This page uses frames, but your browser doesn't support them.
Chimney Peak: May 2004
http://chimneypeak.blogspot.com/2004_05_01_archive.html
Life outdoors in Jacksonville, Alabama. May 04, 2004. Well, I'm back. Actually I've been back since yesterday afternoon but I'm just now getting around to uploading my pictures and posting about my hike. I was too sore to type! There are pictures below, and you can see more of them by clicking here. First and foremost let me say that the Dugger Mountain Wilderness is spectacular! If you haven't seen it for yourself, get out on the Pinhoti Trail as soon as you can. Bruce then took Molly and I through the ...
Chimney Peak: April 2004
http://chimneypeak.blogspot.com/2004_04_01_archive.html
Life outdoors in Jacksonville, Alabama. April 30, 2004. Hey folks, long time, no post. There's a lot of outdoors news coming in the next few days, so I'll soon make up for my lack of presence here lately. I know I've got a few loyal readers, and I need to keep y'all happy. I'm planning another short Pinhoti Hike, probably on section 1 again, or perhaps section two or three. Spring has sprung since I last struck for the wilderness, so there should be lots of GREEN in my next set of pictures. April 22, 2004.
Links | Boy Scout Troop 351 of Madison, AL
http://troop351madison.com/wordpress/t351-home-page/links
Boy Scout Troop 351 of Madison, AL. Meetings: Mondays 7:00-8:30 pm Asbury UMC. Leadership & Contacts. Troop 351 Eagle Scouts. National: Official Boy Scouts of America Web Site. Council: BSA Greater Alabama Council Web Site. District: BSA Talakto District Web Site – Serving all of Madison County. BSA Eagle Scout Project Work Book. Troop 351 Facebook Page. Merit Badge Work Sheets. Leader Training: MyScouting.org. Boy Scout Troop 351 of Madison, AL. Proudly powered by WordPress.
Visitors | City of Anniston, AL
http://www.anniston.org/visitors
Council Member Jay Jenkins. Council Member David Reddick. Council Member Seyram Selase. Council Member Millie Harris. Planning and Development Services. Staff and Contact Information. 2016 Brush Pick-Up Calendar. Serve on a Board or Commission. Anniston-Calhoun County Library Board. Anniston Historic Preservation Commission. Anniston Museum of Natural History Board. Calhoun-Cleburne Mental Health Board. Parks, Recreation, and Beautification Board. Regional Medical Center Board. Water Works and Sewer Board.
Visitors | City of Anniston, AL
http://www.annistonal.gov/visitors
Council Member Jay Jenkins. Council Member David Reddick. Council Member Seyram Selase. Council Member Millie Harris. Planning and Development Services. Staff and Contact Information. 2016 Brush Pick-Up Calendar. Serve on a Board or Commission. Anniston-Calhoun County Library Board. Anniston Historic Preservation Commission. Anniston Museum of Natural History Board. Calhoun-Cleburne Mental Health Board. Parks, Recreation, and Beautification Board. Regional Medical Center Board. Water Works and Sewer Board.
strangedaysinhuntsville.blogspot.com
Blog of Awesomeness
http://strangedaysinhuntsville.blogspot.com/2005_01_01_archive.html
Thursday, January 20, 2005. Its My Birthday and I'll Not Work If I Don't Want To. Posted by Uncle R : 2:15 PM. Tuesday, January 18, 2005. Monday was traveling day. We missed our connection flight and had to stay in Dallas. Tuesday more traveling and finally making it back to Hunts Vegas. Posted by Uncle R : 5:31 PM. Wednesday, January 05, 2005. I'd tried a similar brew called Delerium Nocturnum. Posted by Uncle R : 1:31 PM. ATL Electronic Muzic Scene. Old fit dude tells how to be like him.
Chimney Peak: March 2006
http://chimneypeak.blogspot.com/2006_03_01_archive.html
Life outdoors in Jacksonville, Alabama. March 13, 2006. I used to play in the woods next to our house when I was a kid, but we didn't have a national forest in our backyard. The Decatur Daily has this story. Today on the ordeal of three boys who got lost in the Bankhead National Forest. Here's an excerpt:. We were going to see if it would lead us to a road, but we had already realized then that we were lost.". Posted by Jax42 @ 8:16 AM. March 12, 2006. Posted by Jax42 @ 7:16 AM. Trails beyond THE trail.
Chimney Peak: February 2006
http://chimneypeak.blogspot.com/2006_02_01_archive.html
Life outdoors in Jacksonville, Alabama. February 26, 2006. Has an op-ed in Mississippi's Jackson Clarion-Ledger. Today, on the proposed sale of 14,618 acres of national forest land in the Southeast by the federal government. That includes land in south Alabama's Conecuh National Forest along the Blacwater River. From the op-ed:. Not surprisingly, Vaughan think this sale, and the others, are incredibly bad ideas. The Clarion-Ledger had this Gannett story about the proposed sales on Feb. 26. Va...Apparentl...
Chimney Peak: August 2005
http://chimneypeak.blogspot.com/2005_08_01_archive.html
Life outdoors in Jacksonville, Alabama. August 12, 2005. Here's an interesting story:. But McDermott says he's never laid eyes on the nearly 400-foot waterfall that. Park officials recently discovered in a remote corner of the Whiskeytown. National Recreation Area, 43,000 acres of wilderness in northern California. Read the rest at CNN. I wonder what's out there that nobody knows about in the Talladega National Forest? Posted by Jax42 @ 5:02 AM. August 06, 2005. Posted by Jax42 @ 8:19 AM. August 04, 2005.
TOTAL LINKS TO THIS WEBSITE
70
alabamatrafficticketlawyer.com
Alabama Traffic and Speeding Ticket Attorney/Lawyer Reginald Smith | Alabama AL
Alabama Traffic and Speeding Ticket Attorney/Lawyer • The Smith Law Firm. Why use the Smith Law Firm to fight your Alabama Traffic or Speeding Ticket? Simple: To save a lot of money. Your driving record is extremely valuable, even though most people don’t realize it. The premium you pay for your insurance is based on multiple variables. By far the most important variable is your driving record. Any conviction, even for minor infractions, can show up on your Alabama driving record. Unlike other speeding/t...
alabamatrafficticketpaymentlawyer.com
Alabama Traffic Ticket Payment Lawyer | Alabama Speeding Over the Limit Traffic Lawyer | Initial Consultation at No Charge | FREE Traffic Ticket Consultation
Alabama Traffic Ticket Payment Defense Law Firm. Visit www.AlabamaSpeedingTicket.com. Have you been charged with a Traffic Violation or Speeding Ticket in Alabama? Don’t just pay your ticket on-line without speaking to a Lawyer. Protect your license! Hire an Alabama Traffic Ticket Defense Attorney with the experience you need to protect your license! Visit our website for more information- www.AlabamaTrafficTicketAttorney.com. Wise to Explore All Options Before Simply Paying Your Ticket. From the moment ...
alabamatrafficticketpricesattorney.com
Alabama Traffic Ticket Prices Attorney | Alabama Traffic Lawyer | Initial Consultation at No Charge | FREE Traffic Ticket Consultation
Alabama Traffic Ticket Prices Defense Law Firm. Visit www.AlabamaSpeedingTicket.com. Have you been charged with a Traffic Violation or Speeding Ticket in Alabama? Want to know the traffic ticket prices for fines and costs in Alabama? Hire an Alabama Traffic Ticket Defense Attorney with the experience you need to protect your license! Visit our website for more information www.AlabamaTrafficTicketAttorney.com. Simply Paying Your Ticket Can Have Very Serious Consequences. Out of State Drivers. From the mom...
alabamatrafficviolationsattorney.com
Alabama Traffic Violations Attorney | Alabama Traffic Lawyer | Initial Consultation at No Charge | FREE Traffic Ticket Consultation
Alabama Traffic Violations Defense Law Firm. Visit www.AlabamaSpeedingTicket.com. Have you been charged with a Traffic Violation or Speeding Ticket in Alabama? Hire an Alabama Traffic Ticket Defense Attorney with the experience you need to protect your license! Visit our website for more information www.AlabamaTrafficTicketAttorney.com. Simply Paying Your Ticket Can Have Very Serious Consequences. Out of State Drivers. Working to Help You. From the moment you retain the Alabama traffic defense attorneys,...
alabamatrail.com
Alabamatrailerguy.com
The domain alabamatrailerguy.com may be for sale. Click here to make an offer or call 877-588-1085 to speak with one of our domain experts. This domain may be for sale. Buy this Domain.
Alabama Trailers | Alabama Trailers for Sale, Ratings and Reviews
Trailers, RVs and More. May 20, 2014. Thanks for coming on by AlabamaTrailers.net! We look forward to providing you the latest and greatest on RVs and trailers. Keep checking back for more from us!
Alabama Trail Horse - Explore Alabama By Horseback Riding
Explore Alabama By Horseback Riding. Tips About Owning a Horse. Posted By Kelly Allen. On Mar 8, 2016. Horseback riding is an exquisite feeling of freedom if done in a right way. Owning a horse is just as beautiful as it is responsible aspect of life. Whether you are a professional horse breeder, trainer, veterinarian or just a lover, a rider or a tourist looking for adventurous way of spending your next trip, these pages could serve as guideline for your wishes and needs. Every aspect of horse care is a...
AlabamaTrailofTears.org alabamatrailoftears.org
Trail of Tears Association – Introduction. The Trail of Tears Association (TOTA) is a nonprofit, membership organization formed to support interpretation, development, and the creation . Designated as a national historical trail by Congress the Trail commemorates the forced removal of the Cherokee. People from their homelands in the southeastern United States to Indian Territory (present day Oklahoma) in 1838 – 1839. November 3, 2014 Categories: Uncategorized.