alaskacrewtraining.org alaskacrewtraining.org

ALASKACREWTRAINING.ORG

Alaska Crew Training

Non-profit organization designed to train Alaskans in the film industry. Our goal is to train and develop a list of interns in response to a new State film economic incentive.

http://www.alaskacrewtraining.org/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR ALASKACREWTRAINING.ORG

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

September

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Wednesday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 4.0 out of 5 with 1 reviews
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0

Hey there! Start your review of alaskacrewtraining.org

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

5.7 seconds

FAVICON PREVIEW

  • alaskacrewtraining.org

    16x16

CONTACTS AT ALASKACREWTRAINING.ORG

Alaska Crew Training, Inc

Bob Crockett

P.O. ●●●●●10163

Anc●●●age , Alaska, 99511

US

1.90●●●●2143
1.90●●●●2625
ak●●●●●●●●●●●●@gmail.com

View this contact

Alaska Crew Training, Inc

Bob Crockett

P.O. ●●●●●10163

Anc●●●age , Alaska, 99511

US

1.90●●●●2143
1.90●●●●2625
ak●●●●●●●●●●●●@gmail.com

View this contact

Alaska Crew Training, Inc

Bob Crockett

P.O. ●●●●●10163

Anc●●●age , Alaska, 99511

US

1.90●●●●2143
1.90●●●●2625
ak●●●●●●●●●●●●@gmail.com

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
n/a
UPDATED
2013 August 30
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

NAME SERVERS

1
ns09.domaincontrol.com
2
ns10.domaincontrol.com

REGISTRAR

GoDaddy.com, LLC (R91-LROR)

GoDaddy.com, LLC (R91-LROR)

WHOIS : whois.publicinterestregistry.net

REFERRED :

CONTENT

SCORE

6.2

PAGE TITLE
Alaska Crew Training | alaskacrewtraining.org Reviews
<META>
DESCRIPTION
Non-profit organization designed to train Alaskans in the film industry. Our goal is to train and develop a list of interns in response to a new State film economic incentive.
<META>
KEYWORDS
1 alaska
2 alaska film crews
3 crew
4 crew training
5 entertainment
6 film
7 training
8 workshops
9
10 coupons
CONTENT
Page content here
KEYWORDS ON
PAGE
SERVER
public.app18.tam
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Alaska Crew Training | alaskacrewtraining.org Reviews

https://alaskacrewtraining.org

Non-profit organization designed to train Alaskans in the film industry. Our goal is to train and develop a list of interns in response to a new State film economic incentive.

OTHER SITES

alaskacreeksidecabins.com alaskacreeksidecabins.com

Alaska Creekside Cabins - Lodging Accommodations in Wasilla & Palmer

Office 907.355.4632. Welcome to Capital Reef. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum. Of the community...

alaskacremation.com alaskacremation.com

Home :: Cremation Society of Alaska

Learn About the Society. Our Cremation Code of Ethics. In a few steps, plan and pay online. Join Now. Plan Later. Learn about the Society. May 22, 2015. May 21, 2015. May 16, 2015. May 16, 2015. May 05, 2015. May 02, 2015. May 02, 2015. Apr 27, 2015. Apr 25, 2015. Apr 25, 2015. Apr 25, 2015. Apr 25, 2015. Cremation Society of Alaska. 7216 Lake Otis Parkway. Anchorage, Alaska 99507. Cremation Society of Alaska. 5050 E. Dunbar Drive. Wasilla, Alaska 99654.

alaskacremationsociety.com alaskacremationsociety.com

www.alaskacremationsociety.com

This site is under construction. Why am I seeing this page? Are you the owner of this domain? How to replace this page. Try these searches related to www.alaskacremationsociety.com:. Chapel of the Pine. Cremation Society of Minnesota. Cremation Society of Georgia.

alaskacrew.org alaskacrew.org

Site Unavailable

This site is currently unavailable.

alaskacrewlynx.com alaskacrewlynx.com

Alaska Crewlynx LLC - Home

Your Global Express Crewing and Management Solution. Is crew swapping in Alaska or Canada becoming a time-consuming and expensive option for your Global Express operations? Consider letting Alaska Crewlynx solve this and any other crewing or management needs for your Global Express. I am a highly experienced Global Express Captain with worldwide operational background, whether you are looking for a relief Captain or third / augment pilot, either in Alaska, Canada or anywhere on the globe the need exists.

alaskacrewtraining.org alaskacrewtraining.org

Alaska Crew Training

alaskacrewtransporters.com alaskacrewtransporters.com

Alaska Crew Transporters - Crew carrier buses separate cargo storage

Wildland Fire Crew Carrier Buses. We're not just another school bus. Our best value crew carrier buses have gear separation cages and compartments to transport forest fire fighters and their equipment. A chase truck is not necessary to send a crew and their fireline gear to an incident. Save time, money, paperwork. And fewer inspections for chase trucks by giving us a call at 907-259-5311. We commit to being available 24 - 7. Find us on OLAS! Alaskan owned and operated. Find us on OLAS.

alaskacriminalawyer.com alaskacriminalawyer.com

alaskacriminalawyer.com

alaskacriminalawyers.com alaskacriminalawyers.com

alaskacriminalawyers.com

alaskacriminaldefenseattorneys.com alaskacriminaldefenseattorneys.com

Alaska Criminal Defense Attorneys - Home

Alaska Criminal Defense Attorneys Find the most qualified Cirminal Defense Attorneys. Jump to main navigation and login. Alaska Criminal Defense Attorneys. Find Alaska Criminal Defense Attorneys. Alaska Criminal Defense Attorneys. Published on Friday, 27 September 2013 19:51. Written by Super User. Alaska Criminal Defense Attorneys website can help you find the most qualified Attorneys. Please fill out the forms and an attorney will contact you soon.

alaskacriminaldefenselawyerattorney.com alaskacriminaldefenselawyerattorney.com

Alaska Criminal Defense Lawyers and Attorneys

Criminal Defense HelpLine: 866-757-6949. 8211; Main Menu –. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Internet Sex Crimes Defense. Felon in Possession Defense. Unlawful Possession of Firearm Defense. Receiving Stolen Property Defense. White Collar Crimes Defense. Credit Card Fraud Defense. Other Area of Law. Accessory to Crime Defense. Aiding & Abetting Defense. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Other Area of Law.