alaskamedicaleducators.com alaskamedicaleducators.com

ALASKAMEDICALEDUCATORS.COM

Alaska Medical Educators -

Log In (Reprint Certificates). Log in to Account. AME’s Currently Offered Classes. Expert Instruction, Life Saving Lessons. Log In (Reprint Certificates). Log in to Account.

http://www.alaskamedicaleducators.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR ALASKAMEDICALEDUCATORS.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

August

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Sunday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 3.4 out of 5 with 10 reviews
5 star
2
4 star
4
3 star
2
2 star
0
1 star
2

Hey there! Start your review of alaskamedicaleducators.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

5.2 seconds

CONTACTS AT ALASKAMEDICALEDUCATORS.COM

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
AL●●●●●●●●●●●●●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
AL●●●●●●●●●●●●●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Domains By Proxy, LLC

Registration Private

Domain●●●●●●xy.com

14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309

Sco●●●ale , Arizona, 85260

United States

1.48●●●●2599
1.48●●●●2598
AL●●●●●●●●●●●●●●●●●●●●●●●●@domainsbyproxy.com

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
2013 October 08
UPDATED
2013 October 08
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 12

    YEARS

  • 0

    MONTHS

  • 21

    DAYS

NAME SERVERS

1
ns63.domaincontrol.com
2
ns64.domaincontrol.com

REGISTRAR

GODADDY.COM, LLC

GODADDY.COM, LLC

WHOIS : whois.godaddy.com

REFERRED : http://registrar.godaddy.com

CONTENT

SCORE

6.2

PAGE TITLE
Alaska Medical Educators - | alaskamedicaleducators.com Reviews
<META>
DESCRIPTION
Log In (Reprint Certificates). Log in to Account. AME’s Currently Offered Classes. Expert Instruction, Life Saving Lessons. Log In (Reprint Certificates). Log in to Account.
<META>
KEYWORDS
1 location
2 view directions
3 menu
4 about ame
5 expert staff
6 classes
7 instructors
8 instructor courses
9 students
10 clients
CONTENT
Page content here
KEYWORDS ON
PAGE
location,view directions,menu,about ame,expert staff,classes,instructors,instructor courses,students,clients,slider,coast guard rescue,denali,calendar,laquo; may,connect with us,facebook,twitter
SERVER
Apache
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Alaska Medical Educators - | alaskamedicaleducators.com Reviews

https://alaskamedicaleducators.com

Log In (Reprint Certificates). Log in to Account. AME’s Currently Offered Classes. Expert Instruction, Life Saving Lessons. Log In (Reprint Certificates). Log in to Account.

INTERNAL PAGES

alaskamedicaleducators.com alaskamedicaleducators.com
1

Coast Guard Rescue - Alaska Medical Educators

http://alaskamedicaleducators.com/coast-guard-rescue

Log In (Reprint Certificates). Log in to Account. April 16, 2014. Log In (Reprint Certificates). Log in to Account.

2

Classes - Alaska Medical Educators

http://alaskamedicaleducators.com/classes

Log In (Reprint Certificates). Log in to Account. April 15, 2014. Heart Saver CPR AED. Heart Saver First Aid CPR AED. Babysitter Lessons and Safety Training. Basic Wilderness Life Support. Basic Life Support for Healthcare Provider. HeartCode BLS (Renewals Only). Law Enforcement First Responder Tactical Casualty Care Course. Basic Wilderness Life Support. Heart Saver CPR AED. Heart Saver First Aid CPR AED. Law Enforcement First Responder Tactical Casualty Care Course. Basic Wilderness Life Support.

3

May 2014 - Alaska Medical Educators

http://alaskamedicaleducators.com/2014/05

Log In (Reprint Certificates). Log in to Account. You are browsing the site archives by date. May 2, 2014. Log In (Reprint Certificates). Log in to Account.

4

Denali - Alaska Medical Educators

http://alaskamedicaleducators.com/main-slider-one

Log In (Reprint Certificates). Log in to Account. April 16, 2014. Log In (Reprint Certificates). Log in to Account.

5

Expert Staff - Alaska Medical Educators

http://alaskamedicaleducators.com/expert-staff

Log In (Reprint Certificates). Log in to Account. October 9, 2013. Peter Dillon, MD. Joined our team of instructors July 2013, serving as a lead instructor and medical director. Dr. Dillon currently practices at Tanana Valley Clinic 1. Care and served in the U.S Army, most recently from an assignment as Brigade Surgeon, 1st Stryker Brigade Combat Team, 25th Infantry Division at Ft. Wainwright, AK. When he is not seeing patients or teaching, he enjoys hiking, fishing and exploring Alaska. Thomas is board ...

UPGRADE TO PREMIUM TO VIEW 0 MORE

TOTAL PAGES IN THIS WEBSITE

5

SOCIAL ENGAGEMENT



OTHER SITES

alaskamedicalalert.net alaskamedicalalert.net

Untitled Document

alaskamedicalalert.org alaskamedicalalert.org

Untitled Document

alaskamedicalassistants.org alaskamedicalassistants.org

Alaska Medical Assistants

Affiliate of the American Association of Medical Assistants. State Officers and Committees. The purpose of the American Association of Medical Assistants is to promote the professional identity and stature of its members and the medical assisting profession through education and credentialing. Join us in Fairbanks. May 1 and 2. Find us on Facebook at:. Https:/ www.facebook.com/groups/333417083454242/. I believe in the principles and purpose of the profession of Medical Assisting. I am loyal to my employer.

alaskamedicalcenter.com alaskamedicalcenter.com

www.alaskamedicalcenter.com

This Web page parked FREE courtesy of SundogDomains.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $4.99/mo. Call us any time day or night .

alaskamedicalclinics.com alaskamedicalclinics.com

Wasilla Medical Clinic | Urgent Care & Walk-In Clinic in Wasilla, AK

Wasilla Medical Clinic (907) 373-6055. Articles & Other Educational Materials. Allergy Testing and Treatment. Urgent Care & Injury. Urgent Care & Injury. Immunizations Alaska Medical Clinics provides immunization services to our Alaska patients young and old. Whether you are going on a trip, your child is about to start school or you want to get vaccinated for the latest flu strain going around, we urge you to walk-in or call on of our Alaska Medical Clinics today […]. Occupational Medicine Alaska Medica...

alaskamedicaleducators.com alaskamedicaleducators.com

Alaska Medical Educators -

Log In (Reprint Certificates). Log in to Account. AME’s Currently Offered Classes. Expert Instruction, Life Saving Lessons. Log In (Reprint Certificates). Log in to Account.

alaskamedicaljobs.com alaskamedicaljobs.com

Alaska Medical jobs, Physician jobs, doctor jobs, healthcare jobs, health jobs

Find Alaska Medical Jobs Nationwide! Post your Resume, Review Alaska Medical Salaries! See our Healthcarejobstore Job Directory. Find Alaska Medical Jobs by Location. Post your Resume or Confidential Career Profile, Edit/Deactivate your Career Information & More. Let Employers Nationwide Find You! Sign up for our Job Search Agent and get E-Mail of Jobs that match your search requirements! See ALL of our Health Care Job Store Sites. Find Registered Nurse Jobs. Part of the Health Care Job Store.

alaskamedicallicense.com alaskamedicallicense.com

Welcome to your web site

Welcome to the future Website for healthcarelicensing.com. In order to view your website, please remove this file index.asp and replace it with your own website files.

alaskamedicalmalpracticeattorney.com alaskamedicalmalpracticeattorney.com

alaskamedicalmalpracticeattorney.com

The domain alaskamedicalmalpracticeattorney.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.

alaskamedicalmalpracticeattorneys.com alaskamedicalmalpracticeattorneys.com

Medical Malpractice Alaska - Medical Malpractice Law Firm Alaska

Alaska Medical Malpractice Lawyers. For a fast evaluation of your accident case, submit below. How may we help you? To start protecting your rights today, and to be connected with an experienced Alaska medical negligence lawyer. If you or a loved one has been the victim of medical malpractice, wrong diagnosis or hospital neglect in Alaska CLICK HERE. To contact an experienced Alaska Medical Malpractice Attorney today! Find a Medical Malpractice Attorney, Lawyer or Law Firm near you:. 8226; Montana Medica...

alaskamedicalmalpracticelawyer.com alaskamedicalmalpracticelawyer.com

alaskamedicalmalpracticelawyer.com

The domain alaskamedicalmalpracticelawyer.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.