
APPARTEMENTKOHSAMUI.COM
Appartement Koh Samui: Appartement à louer de haut standing au coeur de Koh SamuiAppartement à louer de haut standing au coeur de Koh Samui
http://www.appartementkohsamui.com/
Appartement à louer de haut standing au coeur de Koh Samui
http://www.appartementkohsamui.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
Fundacion Private Whois
Domain Administrator
Attn: appartemen●●●●●●●●●●●●●●●●ptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
Fundacion Private Whois
Domain Administrator
Attn: appartemen●●●●●●●●●●●●●●●●ptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
Fundacion Private Whois
Domain Administrator
Attn: appartemen●●●●●●●●●●●●●●●●ptds. 0850-00056
Pa●●ma , Zona 15
PA
View this contact
11
YEARS
9
MONTHS
1
DAYS
INTERNET.BS CORP.
WHOIS : whois.internet.bs
REFERRED : http://www.internet.bs
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
2
SITE IP
0.0.0.0
LOAD TIME
0 sec
SCORE
6.2
Appartement Koh Samui: Appartement à louer de haut standing au coeur de Koh Samui | appartementkohsamui.com Reviews
https://appartementkohsamui.com
Appartement à louer de haut standing au coeur de Koh Samui
Hébergements - Site-thailande.com
http://www.site-thailande.com/hebergements
Sites référencés : 88. Sites en attente : 6. Sites refusés : 158. Sites bannis : 3. Mots clés : 57. Critères de recherche. Retrouvez sur site-thailande.com tous les sites internet sur les hébergements en Thailande. Le guide de Koh Samui, Thaïlande. reservations en ligne de tous les hôtels de Koh Samui, kohTao, FULL MOON. Five Stars Transaction Immobilières. Vous souhaitez acheter, vendre ou louer en Thaïlande? L'agence immobilière Five Stars vous propose tous les types. Maisons à louer à Phuket. Spacieus...
Les nouveaux sites référencés - Site-thailande.com
http://www.site-thailande.com/nouveautes.html
La Thailande sur le Web. Sites référencés : 88. Sites en attente : 6. Sites refusés : 158. Sites bannis : 3. Mots clés : 57. Critères de recherche. Les nouveaux sites référencés. Trouver un hôtel de luxe à Bangkok. Si vous prévoyez de partir en vacances à Bangkok et que vous cherchez en particulier un hôtel de luxe où vous. Location scooter moto Phuket. Station Motorbike For Rent est une agence de location de scooter située à Phuket depuis plusieurs années. Le parc. Locations de villas à Phuket. Free Cla...
TOTAL LINKS TO THIS WEBSITE
2
AppartementKlaver4 | Ameland Hollum
Appartement Kleinwalsertal | Oostenrijk
Vakantie voor het hele gezin. Het Kleinwalsertal in Oostenrijk is het vakantiegebied voor families in zowel zomer als winter. Het gebied maakt onderdeel uit van de Allgäuer Alpen. In het Kleinwalsertal kun je naar hartenlust skiën, langlaufen, bergwandelen, mountainbiken en nog veel meer. Het dal bestaat uit de 4 gezellige dorpen Riezlern, Hirschegg, Mittelberg en Baad, waar alle voorzieningen binnen handbereik zijn. 124 km aan sneeuwzekere pisten. Op slechts 790 km vanaf Utrecht. Tussen 25-03 en 22-04-2...
familievakantiekleinwalsertal.nl - Home
Welkom in het Kleinwalsertal! Van harte welkom op onze website die gaat over genieten en vakantie vieren in het Kleinwalsertal. We komen er zelf al vele jaren en hebben sinds 2010 drie appartementen in het Aparthotel in Mittelberg (sinds 2012 een derde). Alpenroos, Bergnarcis en Zonnehoed. Elk appartement heeft zijn eigen parkeerplaats in de garage. U kunt vanuit de garage direct intern met de lift naar de appartementen. Al onze appartementen hebben nu een flatscreen TV en WIFI in alle kamers.
Vernieuwd ruim appartement te huur en te koop
Nieuw ruim appartement te huur/koop. 50 m van zee, 50 m van Delhaize, 150 m van de Lippenslaan;. Aan het in 2006-2008 vernieuwde Lichttorenplein;. 130 m, 3 grote slaapkamers;. Ondergrondse parkeergarage voor de deur. Topligging in Knokke-Zoute: la vie en rose.
appartement Knokke Heist
Knokke-Heist : budgetvriendelijk appartement op 30 meter van het strand! Knus appartement ( 50 m? Residentie Paola ) in Knokke-Heist. Op 30 meter van strand en zee. Op 100 meter van de tramhalte. Kusttram Knokke (10 min) - De Panne. Op 300 m van het winkelcomplex (Delhaize, E5, Brantano, Bel &Bo enz.). Op 500 m van de markt in Heist (markt op dinsdagvoormiddag). Op 1000 meter van het station NMBS van Heist. Kindvriendelijke ruimtes, twee tot maximaal 4 personen (comfortzone). Flat screen-TV op de muur.
Appartement Koh Samui: Appartement à louer de haut standing au coeur de Koh Samui
Appartement à louer de haut standing au coeur de Koh Samui. Vue mer depuis la terrasse. Appartement a louer avec piscine. Appartement tout confort pour vos vacances à Koh Samui. De nombreux services (payants) seront à votre disposition si vous le souhaitez dans la résidence. Les draps sont changés une fois par semaine, ce service est gratuit. Un petit-déjeuner vous est également offert à votre arrivée. Appartement très agréable. Les propriétaires sont accueillants et à notre service! 3/3 Moo.6 Bophut,.
appartementkopen.nl - This website is for sale! - appartementkopen Resources and Information.
The owner of appartementkopen.nl. Is offering it for sale for an asking price of 699 EUR! This webpage was generated by the domain owner using Sedo Domain Parking. Disclaimer: Sedo maintains no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo nor does it constitute or imply its association, endorsement or recommendation.
Pagina niet gevonden / Page not found
Pagina niet gevonden / Page not found. De pagina die u opvroeg bestaat niet. Controleer het adres op typefouten zoals ww.voorbeeld.com in plaats van www.voorbeeld.com en probeer het opnieuw. The page you requested does not exist. Please check the address for typos like ww.example.com instead of www.example.com and try again.
Index of /
Appartement op Kreta boeken
Populairste bestemmingen op Kreta. Wanneer je naar de populairste bestemmingen kijkt welke in grote mate op Kreta aanwezig zijn dan is er 1 uitblinker, namelijk Chersonissos. Deze badplaats is na de serie Oh Oh Cherso nog meer in populariteit gestegen en is nu het meest bezochte vakantieoord door Nederlanders op Kreta! Daarnaast doen de stad Rethymnon. Welke aan de west zijde van het eiland aan de noordkust gelegen is, en de plaats Sissi. Waar kan je een appartement op Kreta boeken? Zeker als je van cult...
Appartement Kroatie - Omis Riviera - een parel in midden Dalmatie
Apache is functioning normally.