ausablevalleyinn.com ausablevalleyinn.com

AUSABLEVALLEYINN.COM

Home

Nice and cozy 28 room motel located just north of the AuSable river on M-33 in beautiful up north Michigan.

http://www.ausablevalleyinn.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR AUSABLEVALLEYINN.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

December

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Saturday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 3.6 out of 5 with 13 reviews
5 star
2
4 star
6
3 star
4
2 star
0
1 star
1

Hey there! Start your review of ausablevalleyinn.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

1.1 seconds

FAVICON PREVIEW

  • ausablevalleyinn.com

    16x16

CONTACTS AT AUSABLEVALLEYINN.COM

McEachren, Thomas

3612 ●●●●●r St.

Dea●●●orn , MI, 48124

US

View this contact

McEachren, Thomas

3612 ●●●●●r St.

Dea●●●orn , MI, 48124

US

1.31●●●●4044
tm●●●●●●●●@gmail.com

View this contact

McEachren, Thomas

3612 ●●●●●r St.

Dea●●●orn , MI, 48124

US

1.31●●●●4044
tm●●●●●●●●@gmail.com

View this contact

McEachren, Thomas

3612 ●●●●●r St.

Dea●●●orn , MI, 48124

US

1.31●●●●4044
tm●●●●●●●●@gmail.com

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
n/a
UPDATED
2013 December 27
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

NAME SERVERS

1
dns1.hostrack.com
2
dns2.hostrack.com

REGISTRAR

OMNIS NETWORK, LLC

OMNIS NETWORK, LLC

WHOIS : whois.omnis.com

REFERRED : http://domains.omnis.com

CONTENT

SCORE

6.2

PAGE TITLE
Home | ausablevalleyinn.com Reviews
<META>
DESCRIPTION
Nice and cozy 28 room motel located just north of the AuSable river on M-33 in beautiful up north Michigan.
<META>
KEYWORDS
1 Hotel
2 Motel
3 Inn
4 Resort
5 Pool
6 Suite
7 Jacuzzi
8 King
9 Queen
10
CONTENT
Page content here
KEYWORDS ON
PAGE
toggle navigation,amenities,local attractions,reservations,sincerely,your hosts,ausable valley inn,back to top
SERVER
Apache
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Home | ausablevalleyinn.com Reviews

https://ausablevalleyinn.com

Nice and cozy 28 room motel located just north of the AuSable river on M-33 in beautiful up north Michigan.

INTERNAL PAGES

ausablevalleyinn.com ausablevalleyinn.com
1

Reservations

https://www.ausablevalleyinn.com/reservations.html

515 Lockwood Lane / PO Box 249. Mio, MI 48647.

2

AuSable Valley Inn - Amenities

https://www.ausablevalleyinn.com/amenities.html

2 Queens or 1 King). 1 King, 1 Queen sofa). 515 Lockwood Lane / PO Box 249. Mio, MI 48647. We have 4 room styles and several amenities for you to enjoy:. 8226; PC available for all motel guests in our lobby! 8226; FREE Wi-Fi access for all guests! 8226; Cable TV (HBO). 8226; In-Room Jacuzzis. 8226; All Queen and King Beds. 8226; Continental Breakfast. 8226; 24 Hour Front Desk Staff. 8226; Major Credit Cards accepted. 8226; Indoor Heated Pool. 8226; Hot Tub. 8226; Air Conditioning. 8226; In-Room Phones.

3

AuSable Valley Inn

https://www.ausablevalleyinn.com/attractions.html

515 Lockwood Lane / PO Box 249. Mio, MI 48647. Enjoy the "Up North" Experience! Near AuSable River for canoeing, rafting, kayaking, tubing and fishing. Bull; Hinchman Acres - hinchman.com. Bull; Gott’s Landing - gottslanding.com. 989)826-3411 or (888) 226-8748. Bull; Parmalee Trading Post - (989) 826-3543. Bull; Thousands of acres of public land for riding your ORV, Snowmobiling, Hunting, Cross County Skiing, Horseback Riding, and Hiking. – Huron-Manistee National Forests. 38; Michigan DNR. For additiona...

UPGRADE TO PREMIUM TO VIEW 0 MORE

TOTAL PAGES IN THIS WEBSITE

3

LINKS TO THIS WEBSITE

mobleyengineering.com mobleyengineering.com

Mobley Engineering

http://www.mobleyengineering.com/ourfavorites.html

Design and installation of aeration systems for hydropower, water supply reservoirs and other applications. Because we build our systems on-site, we thought we'd share some of our favorite things from the areas where we work- sort of a travelogue-. This could be anything from local brews, restaurants, mountain biking trails, etc. So be sure to check back later! While on site, we work 6 days per week, usually 10 hours per day. These relfect our one day off per week, our day of rest! Located near St. P...

brucesausableangler.com brucesausableangler.com

AREA INFO

http://www.brucesausableangler.com/AREA_INFO.html

Bruce's Au Sable Angler. Mio, MI 48647. Area Resources and Links. Click on underlined to visit links.). Kevin Feenstra Guide Service. Riverquest Charters - West Michigan, www.riverquestcharters.com. Midwest Fly Fishing Magazine. Oscoda County Web Site. US Forest Service - Mio - 989-826-3252. Au Sable Valley Inn. Private cabin) - 989-848-5558. Holiday Motor Inn - 989-826-3743. Island View Cottage www.island-view-cottage.com. Four Seasons Motel - 989-826-6400. Mio Motel - 989-826-3248. Gates Au Sable Lodge.

fishingecstasy.blogspot.com fishingecstasy.blogspot.com

Fishing is my Ecstasy: MidWest Fly Fishing Expo 2011 - ORGASMIC!!! (number 1, there's another coming)

http://fishingecstasy.blogspot.com/2011/03/midwest-fly-fishing-expo-2011-orgasmic.html

Fishing is my Ecstasy. Tuesday, March 15, 2011. MidWest Fly Fishing Expo 2011 - ORGASMIC! Number 1, there's another coming). Ahwhere to begin, I have so much in my head that it is just exploding! It was the greatest abundance of fly fishing knowledge, experience, and addicts I have ever encountered all in one gathering. Okay, so I was also a virgin Fly Fishing EXPO. Attender, which I can now no longer say. Since I have no means of comparison, the bar has been set pretty high because of this experience.

mobleyengineering.com mobleyengineering.com

Mobley Engineering

http://www.mobleyengineering.com/ourfavorites/damtour.html

Design and installation of aeration systems for hydropower, water supply reservoirs and other applications. Wallenpaupack, PA.Croton, MI.Mio, MI. and Tippy, MI. In June, a few of us did about a two week "damn tour" to take care of some maintenance. We had no days off, but a couple of travel days allowed us enough free time to do a little exploring. After a quick visit to Lake Wallenpaupack. In Hawley, PA, and having stayed in our favorite accomodations there at the East Shore Lodging. Pleasant Lake, MN.

snolodging.com snolodging.com

SnoLodging.com - Snowmobile, Ski, Snowboard and Winter Sport Vacation Lodging

http://www.snolodging.com/SledMidwest.asp

Snowmobile, Ski and Winter Sport Vacations. Tug Hill / Thousand Is. Old Forge / Adirondacks. Central / Finger Lakes. Catskills / Capital Reg. Hudson Valley and South. Aroostook, D'east, Acadia. Poconos / Eastern Pa. All Price Edward Islands. Place A New Listing. Call us toll free at. 888) 456 - 0208. For a Warmer Alternative Visit. Created and Maintained By. North Coast Inn and Chalets. Best Western Derby Inn. Eagle River, WI. Park Falls, WI. Hilltop Motel - L'anse. St Germain, WI. St Germain, WI.

eastbigcreek.com eastbigcreek.com

Lodging

http://www.eastbigcreek.com/lodging/index.htm

On the AuSable East of Grayling. On the AuSable West of Mio. North of Mio off Kittle Rd. Rt 72 in Luzerne.

fishingecstasy.blogspot.com fishingecstasy.blogspot.com

Fishing is my Ecstasy: April 2011

http://fishingecstasy.blogspot.com/2011_04_01_archive.html

Fishing is my Ecstasy. Thursday, April 21, 2011. The way to my heart is through a great rod! Well, it's official! I will be streamer fishing with my new Kelly Galloup's St. Croix Bank Robber. 6 wt 9' rod on May 8th! In case you weren't aware, I'm giving you the heads up, it's Mother's Day! Scott Smith - Do you think it's big enough? 65279;As you might recall, I was the very lucky winner of Au Sable Angler's. Raffle for a full day guided trip and lodging from the AuSable Valley Inn. When not repairing te...

fishingecstasy.blogspot.com fishingecstasy.blogspot.com

Fishing is my Ecstasy: March 2011

http://fishingecstasy.blogspot.com/2011_03_01_archive.html

Fishing is my Ecstasy. Sunday, March 27, 2011. MidWest Fly Fishing Expo 2011 - ORGASMIC! I love surprises, even ones I know are coming! As promised, I received my saltwater flies. But, I also received a 5% discount on a trip and MORE than a dozen flies. Thank you again to Mud Dog Saltwater Flies. And Life on the Fly Outfitters. I have no idea what these flies are called or where they are best used. Help! If anyone knows, please feel free to comment on them individually. 65279;   . A utility baitfish p...

fishingecstasy.blogspot.com fishingecstasy.blogspot.com

Fishing is my Ecstasy: The way to my heart is through a great rod!

http://fishingecstasy.blogspot.com/2011/04/way-to-my-heart-is-through-great-rod.html

Fishing is my Ecstasy. Thursday, April 21, 2011. The way to my heart is through a great rod! Well, it's official! I will be streamer fishing with my new Kelly Galloup's St. Croix Bank Robber. 6 wt 9' rod on May 8th! In case you weren't aware, I'm giving you the heads up, it's Mother's Day! Scott Smith - Do you think it's big enough? 65279;As you might recall, I was the very lucky winner of Au Sable Angler's. Raffle for a full day guided trip and lodging from the AuSable Valley Inn. When not repairing te...

UPGRADE TO PREMIUM TO VIEW 1 MORE

TOTAL LINKS TO THIS WEBSITE

10

SOCIAL ENGAGEMENT



OTHER SITES

ausablevalleyaudubon.com ausablevalleyaudubon.com

AuSable Valley Audubon | A chapter of Michigan Audubon

A chapter of Michigan Audubon. Field Trips and Walks with Guides. Annual Christmas Bird Count. Volunteer Invasive Plants Removal. Oscoda Area Kirtland’s Warbler Tours. 501c3 Charitable Organization Donations and Grants Information. February 18, 2018. Recognizing Ed Cole for his Contributions to AuSable Valley Audubon as part of the 45. Ed joined the AuSable Valley Audubon about 12 years ago when he was in his mid-80’s! Some of his specific contributions include:. The AuSable Valley Audubon Trumpeter.

ausablevalleyaudubon.org ausablevalleyaudubon.org

AuSable Valley Audubon | A chapter of Michigan Audubon

A chapter of Michigan Audubon. Field Trips and Walks with Guides. Annual Christmas Bird Count. Volunteer Invasive Plants Removal. Oscoda Area Kirtland’s Warbler Tours. 501c3 Charitable Organization Donations and Grants Information. February 18, 2018. Recognizing Ed Cole for his Contributions to AuSable Valley Audubon as part of the 45. Ed joined the AuSable Valley Audubon about 12 years ago when he was in his mid-80’s! Some of his specific contributions include:. The AuSable Valley Audubon Trumpeter.

ausablevalleyaudubon.wordpress.com ausablevalleyaudubon.wordpress.com

AuSable Valley Audubon | A Chapter of Michigan Audubon

A Chapter of Michigan Audubon. FALL 2010 – 2011 FIELD TRIPS. FALL 2010 – 2011 AVA Meetings. 2009 Annual CBC results. Tawas Point Birding Festival 2010 Results. Tawas Bird Sightings Archives. SANDHILL CRANES — AVA Oct. 30 field trip. October 22, 2010 in Uncategorized Leave a comment. The evening viewing of the cranes was AWESOME! Sorry if you missed our field trip! The Sandhill Crane is our November 9th meeting topic. Open the above link ( 2010-2011 AVA meetings). Pairs vocalize in a behavior known as &#8...

ausablevalleygrange.com ausablevalleygrange.com

Shop - ausablevalleygrange.com

Us wholesale jerseys cheap. Former Leeds winger and United States international Rogers revealed he was gay in February 2013 and at the same time announced his retirement from football at the age of 25. Without them, players would be free to grab, claw, and tackle one another. NCAA jerseys. Developer Imangi Studios had thought this out well from the beginning. "I'm so excited. Lots of other nations look so plain and flat. wholesalejerseysi. No products were found matching your selection.

ausablevalleygrangefarmersmarkets.com ausablevalleygrangefarmersmarkets.com

Home

Ausable Valley Grange Farmers Markets. The AuSable Valley Grange Farmers' Markets are the only "producer-only" farmers' markets in the eastern Adirondacks. At "producer-only" markets, the vendors can sell only items that they or their employees produce. Vendors cannot buy in bulk and then proceed to resell to you. If you are a farmer or food producer with high standards and an interest in joining a growing, energized community, come and join us in the towns of Lake Placid, Saranac Lake, or Schroon Lake!

ausablevalleyinn.com ausablevalleyinn.com

Home

Come enjoy the great up-north in a beautiful 28 room motel located just north of the AuSable River on M-33. No matter what time of year there is always something to do. Visit our local attractions page to get a glimpse of what is available during your stay. Thanks for visiting and please come back again and let us know what you think of the site. Bruce and Jackie Graff. 515 Lockwood Lane / PO Box 249. Mio, MI 48647. 2018 Ausable Valley Inn.

ausablevalleypatriots.com ausablevalleypatriots.com

Ausablevalleypatriots.com

This domain may be for sale. Backorder this Domain. This Domain Name Has Expired - Renewal Instructions.

ausablevalleyproperties.com ausablevalleyproperties.com

Ausable Valley Properties

Real Estate for sale or Rent. March 16, 2018. 4 Bedroom / 2 Bath House. Near Lake Placid, NY.

ausablevalleyrealty.homesandland.com ausablevalleyrealty.homesandland.com

AuSable Valley Realty homes for sale, listings, and real estate properties in the MIO, Michigan area.

Find Traverse City homes for sale, and Traverse City home values. Traverse City Area Homes For Sale. Traverse City Real Estate. Harbor Springs Real Estate. Traverse City Area Zip Codes. 49684 Real Estate in Traverse City, MI. 49735 Real Estate in Gaylord, MI. 49601 Real Estate in Cadillac, MI. 49686 Real Estate in Traverse City, MI. 49721 Real Estate in Cheboygan, MI. Traverse City Area Properties. Traverse City Commercial Properties. Traverse City Ranch Properties. Traverse City Lots Acreage.

ausablevalleytrailriders.com ausablevalleytrailriders.com

Au Sable Valley TrailRiders - HOME

Au Sable Valley TrailRiders. TRAIL INFORMATION AND MAPS. Check out our Facebook Page. Welcome to our Web Site! We Ride Them All. Ride Safe, Ride with a Friend!

ausablevalleyviewfarm.com ausablevalleyviewfarm.com

Tod'S Scarpe Vendita Milano Negozi | Mbt Scarpe Italia Compra Sconto, Trasporto Veloce E Sicuro Italia Online Comprare

My Cart: 0 Item(s). Cartelle e borse per laptop. Cosmetica e profumeria uomo. Cosmetici e profumeria donna. Cosmetici per il corpo. Cosmetica e profumeria uomo. Cosmetici e profumeria donna. Cosmetici per il corpo. Lozioni e oli per il corpo. Scarpe MBT M. Walk. Delle Donne Di Forma Up. Moncler Cappelli e Sciarpa Imposta. Hogan Newest Men Shoes. Mens Tods Heaven Laccetto. Tod's Sneakers For Men. Tods Floral Lace Shoes. Tods Gommino Leather Mens. Tods Gommino Leather Womens. Tods Gommino Shoes Mens. Pepe ...