Learn to swim, 'The Becky Way'. We have a variety of lessons for your children to learn to swim. We have low class sizes, excellent teachers and lessons designed by Becky Adlington
http://www.beckyadlingtonsswimstars.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.4 seconds
total swimming
steve parry
Total Swim●●●●●●●●●●e of Sport
Bury Gre●●●●●●●●nchester , Lancashire, BL9 0UF
GB
View this contact
total swimming
steve parry
Total Swim●●●●●●●●●●e of Sport
Bury Gre●●●●●●●●nchester , Lancashire, BL9 0UF
GB
View this contact
Webfusion Limited
5 Roun●●●●●●Avenue
Stoc●●●●Park , Uxbridge, UB11 1FF
GB
View this contact
BUY YOUR DOMAIN
12
YEARS
10
MONTHS
1
DAYS
WEBFUSION LTD.
WHOIS : whois.123-reg.co.uk
REFERRED : http://www.123-reg.co.uk
PAGES IN
THIS WEBSITE
15
SSL
EXTERNAL LINKS
150
SITE IP
109.107.38.5
LOAD TIME
1.383 sec
SCORE
6.2
Home | SwimStars | beckyadlingtonsswimstars.com Reviews
https://beckyadlingtonsswimstars.com
Learn to swim, 'The Becky Way'. We have a variety of lessons for your children to learn to swim. We have low class sizes, excellent teachers and lessons designed by Becky Adlington
beckyadlingtonsswimstars.com
Swimming Ability Matrix | Swim Stars
https://www.beckyadlingtonsswimstars.com/matrix
If you are booking lessons for your child with Becky Adlingtons. And are unsure which ability group. To choose, try our easy to use Ability Matrix. This will enable you to identify the correct group for your child and book your swimming lessons online. Is your child over 3 years of age? Is your child under 3 years of age? Is your child able to. Independently paddle (without floats) consistently and confidently on front and back for 5 metres? Put their face in the water whilst swimming? Be confident in th...
Find A Class | Swim Stars
https://www.beckyadlingtonsswimstars.com/book-now
Find a class near you. East Riding of Yorkshire. Adult Learn to Swim. 1 to 1 (adult only). Not sure of your ability? Use our ability matrix. For Ability Descriptions Click Here. Sign in to rebook. Select an area above or search by address to find venues near by. Elm Square, Next to Total Fitness. Bury New Road, Whitefield,. Manchester , M45 7TA. Some calls may be recorded for training purposes.
Home | Swim Stars
https://www.beckyadlingtonsswimstars.com/why-swim-stars-becky-adlingtons-swimstars-journey
Our Life in Rio. Becky's Rio Photo Album. With Becky now home from the Olympics we thought it would be great to put together her Rio &. Becky signs off from Rio - with love! Hours after Team GB celebrated their final medal in the swimming pool, Becky sent us her last Rio . Becky gets on her bike to watch another sport! It’s my 3rd Olympic Games and you might be surprised that last night I had my first ex. Becky loses her Olympic record - and is thrilled! Learn to swim 'the Becky way'. Manchester , M45 7TA.
Error 404 | Swim Stars
https://www.beckyadlingtonsswimstars.com/venue-finder
This page can not be found. Elm Square, Next to Total Fitness. Bury New Road, Whitefield,. Manchester , M45 7TA. Some calls may be recorded for training purposes.
Careers | Swim Stars
https://www.beckyadlingtonsswimstars.com/careers
Would you like to work for us? If you feel you could contribute positively to our team, please check back regularly to see the opportunities available. Please see our current vacancies below:. Becky Adlingtons SwimStars are looking for passionate, enthusiastic and organised swimming teachers to join our Learn to Swim programme delivered at centres across the UK. Where are you from? How can we help? Elm Square, Next to Total Fitness. Bury New Road, Whitefield,. Manchester , M45 7TA.
TOTAL PAGES IN THIS WEBSITE
15
Careers - LivingWell Prague
http://prague-en.livingwell.com/careers
If you’d like to bring Personalised fitness for life to more people, have a look at our current employment opportunities on our recruitment site: www.careersathilton.com. Join the club that cares. Stay up to date with us. POLICIES & LEGAL. Cookies and Privacy Policy. Hilton Hotels and Resorts. UK active Matrix - Flame Awards 2014 winner.
site.swimstars.cleversteam.com
Back To School | Swim Stars
http://site.swimstars.cleversteam.com/back-to-school
All of our children are now back to school and hopefully settled in their new classes and making new friends! Are your children already attending swimming lessons? If not, why not look at booking them on to one of our courses throughout your region? Do your children have friends who haven’t yet learnt to swim? Back to school is a perfect time for them to start learning a new skill they can then have fun with new class friends. ALSO - Keep your eyes open for an event coming up that children who are alread...
site.swimstars.cleversteam.com
Taster Sessions | Swim Stars
http://site.swimstars.cleversteam.com/celebration-days
During the Autumn half term we will be running a variety of classes for your child to get involved with. To book, please Select Venue:. No upcoming events, please check back soon! Where are you from? How can we help? Elm Square, Next to Total Fitness. Bury New Road, Whitefield,. Manchester , M45 7TA. Mon - Thu 8.30am - 7.00pm, Fri 8.30am - 5.30pm and Saturday 9.00am - 12.00pm. Some calls may be recorded for training purposes. Becky and Bannatynes - all going swimmingly!
site.swimstars.cleversteam.com
The Becky Way | Swim Stars
http://site.swimstars.cleversteam.com/the-becky-way
I am very proud of what I have achieved so far, but my journey is not finished yet. My vision is that every child in Britain will be able to swim by the time they leave primary school. Being able to swim is such a wonderful life skill, and I see this as my greatest challenge yet. I am thrilled with the response to SwimStars, and already thousands of young people have learned to swim with us. I hope you will allow me and my team to teach your children to swim ‘The Becky Way’. “. Where are you from?
site.swimstars.cleversteam.com
Useful Information | Swim Stars
http://site.swimstars.cleversteam.com/faqs
Advice from Becky’s Mum (Kay Adlington. We know that as a parent you may have some questions about our courses and your children attending swimming lessons. Who better to ask than Beckys mum, Kay Adlington. Who has certainly been through the journey, and offers this advice :. Five tips for parents of children going to swimming lessons for the first time. Keep it simple – dont force the issue. They are going to have fun and build confidence. Take them when they are ready. Becky used to like having a choco...
site.swimstars.cleversteam.com
Monthly Testimonials - February 2017 | Swim Stars
http://site.swimstars.cleversteam.com/news-monthly-testimonials
Monthly Testimonials - February 2017. Monthly Testimonials - February 2017. Here at Becky Adlingtons SwimStars we love to hear your feedback. We work so hard to provide the best service we can so when we hear positive comments, it makes it all worth while. Below are a few of the comments from our customers over the last month:. What are your overall thoughts on the swimming lessons and service that we are providing? My daughters technique has improved so much ini the first few weeks. Manchester , M45 7TA.
site.swimstars.cleversteam.com
Why SwimStars? | Swim Stars
http://site.swimstars.cleversteam.com/why-swim-stars
Is a learn to swim programme. Designed for children aged between 3 and 11 years old. Are structured initially around a 4 year journey (to mimic an Olympic cycle) which has been designed to mimic Becky’s favourite. And World Record swim, the 800m. Includes a teaching programme. With teachers who have received training in teaching the Becky way and a rewards scheme that inspires and motivates children about being the best that they can be. The programme. Why Becky Adlington’s. There are dedicated resources...
site.swimstars.cleversteam.com
Rookie Lifeguard | Swim Stars
http://site.swimstars.cleversteam.com/learn-to-swim-rookie-lifeguard
We’re delighted at SwimStars to announce our new swim programme, Rookie Lifeguard. The programme is run in conjunction with the Royal Life Saving Society UK and its aim is to teach children as much as possible about being safe in and around water and ensure they feel comfortable, whether in the pool or in the sea. Rookie Lifeguard has been designed to run parallel to your child’s current SwimStars classes and will only enhance their confidence and technique in the pool. What can you expect on the course?
site.swimstars.cleversteam.com
1-2-1 lessons | Swim Stars
http://site.swimstars.cleversteam.com/learn-to-swim-1-2-1-lessons
1-2-1 lessons for adults and children. The major benefit of 1-2-1 is that your lessons will be tailored to your individual needs. Different people learn in different ways, so our teachers will take the time to get to know you and teach you in a way that brings the best results. This will mean that you will see progress much quicker than in a group environment. Call 0161 979 0499 to check availability. 1 in 5 adults in the UK are unable to swim – but it’s never too late to learn! Our 121 swimming lessons ...
TOTAL LINKS TO THIS WEBSITE
150
Becky Adams | My passions, living well, living my dreams and helping others along the ride!
My passions, living well, living my dreams and helping others along the ride! June 6, 2011. Fearlessless good health high energy focus love = success and happiness. Personal Development and happiness. Women in Business, Entrepreurship, Marketing. January 7, 2011. Is is still OK to be going round saying happy new year? Have people already started thinking ‘OK enough’s enough with the happy new year’? Well happy new year anyway! The dreaded tax return. Getting organised for baby and business. Personal Deve...
beckyadamsnlglfinalsynthesis.weebly.com
Home
Elements of IICASL and NLGL Connections. Personal Impacts and Future Work. New Literacies and Global Learning Final Synthesis Project. Retrofitting Our Global Perspectives. Becky Adams, 2014. Create a free website.
Becky A. Davis | The Growth Accelerator Expert | MVPwork - Home
Have you had enough of the hustle and bustle, grit and grind, and frustration of working for someone else? Are you tired of the corporate America rat race and the 9-5 song and dance routine -. But you need help navigating the mysteries of becoming an entrepreneur with less mistakes? Becky Davis cuts through the confusion and helps you bee-line straight for entrepreneur success with her BOSSpreneur™ Career Transition Blueprint. Some of what you will Learn. Are you ready to take the leap? Was engaging, pra...
Tattoo Art by Becky Barker - No 9 Custom Tattoo
Tattoo art by bexx, Malvern No 9 Custom Tattoo. No 9 Custom Tattoo Studio. Tattoo Art by Becky. No 9 is a completely private, appointment only custom tattoo studio situated above Malvern Hair and Beauty Emporium. There is no access to the studio without prior arrangement. This means that firstly, there are no interruptions whilst you are being tattooed. And also appointments are available between the hours of 10am and 10pm. Bookings are available with Becky during the following days and times:.
Home | SwimStars
How to update your card details: Watch our step-by-step guide. Re-booking made easy: Watch our step-by-step guide. Advice from Becky's Mum. Partnership with Everyone Active. The only kids swimming programme written by Britian's most successful female swimmer. Becky talks motherhood and health. Becky has spoken to the Daily Mirror about how important she feels it is to encourage daughte. Ready for the holidays. Learn to swim 'the Becky way'. Founded by rebecca adlington obe. Bury New Road, Whitefield,.
Home | Becky Adlington Training Academy
Only 2 spaces left on our upcoming Level 1 course. We’ve had a great response since the end of the Christmas and New Year to our Level 1 course. Why Becky believes in Becky Adlington Training. Being Britains most successful swimmer it would have been easy for Becky Adlington to simply . We believe that we are the best teacher training company around, but we dont want you to just. Becky is also a qualified teacher. Founded by Rebecca Adlington OBE. Becky Adlington Training Ltd. Manchester , M45 7TA.
beckyadrianserendylan.blogspot.com
beckyadrianserendylan
Home : Becky A Fansher : Northwestern Mutual
500 Elm Grove Rd Ste 201. Elm Grove, WI 53122-2546. 500 Elm Grove Rd Ste 201. Elm Grove, WI 53122-2546. Sign Up for My. Creating Financial Plans for Your Business and Family. For many business owners and busy professionals, there’s little time left after career and family to deal with personal finances. Unfortunately, being too busy can be costly. The Northwestern Mutual Difference. Backed by the strength of Northwestern Mutual, my team and I provide you with a balanced approach to achieving your goal of...
Becky Friedman | Producer | beckyafriedman@gmail.com
SOCIAL ENGAGEMENT