campcavell.org
Camp CavellThere are many different ways to donate. Camp Cavell 3335 Lakeshore Road, Lexington, Michigan 48450. Tele: (810) 359-2267 e-mail: office@campcavell.org. 2011-2018 Camp Cavell All rights reserve.
http://www.campcavell.org/
There are many different ways to donate. Camp Cavell 3335 Lakeshore Road, Lexington, Michigan 48450. Tele: (810) 359-2267 e-mail: office@campcavell.org. 2011-2018 Camp Cavell All rights reserve.
http://www.campcavell.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
1 seconds
YWCA Camp Cavell
YWCA Camp Cavell
3335 L●●●●●●re Dr.
Lex●●●ton , Michigan, 48450
US
View this contact
R.A. McAllister
2647 H●●●●●●e East
Kin●●●ton , Georgia, 30145
US
View this contact
Rebecca McAllister
2647 E●●●●●●AGE RD
KIN●●●TON , Georgia, 30145-1021
US
View this contact
BUY YOUR DOMAIN
GoDaddy.com, LLC (R91-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
18
SSL
EXTERNAL LINKS
10
SITE IP
108.60.222.193
LOAD TIME
0.969 sec
SCORE
6.2
Camp Cavell | campcavell.org Reviews
https://campcavell.org
There are many different ways to donate. Camp Cavell 3335 Lakeshore Road, Lexington, Michigan 48450. Tele: (810) 359-2267 e-mail: office@campcavell.org. 2011-2018 Camp Cavell All rights reserve.
campcavell.org
Camp Cavell
http://www.campcavell.org/index.html
Camp Cavell 3335 Lakeshore Road, Lexington, Michigan 48450. Tele: (810) 359-2267 e-mail: cavell@campcavell.org. 2011-2016 Camp Cavell All rights reserve.
Camp Cavell-FAQ Women Camp
http://www.campcavell.org/website/FAQ/women.html
FAQ - Women Camp. Click a Question for an Answer or scroll. Who owns YWCA Camp Cavell? What is the difference between the YMCA and the YWCA? Is the Camp open during the winter? What about Mosquitoes and Wildlife? How old is YWCA Camp Cavell and how did it get started? If you have any more questions. Please call the Camp Office at (810) 359-2267. Who owns YWCA Camp Cavell? YWCA Camp Cavell is owned and operated by the YWCA of Metropolitan Detroit. What is the difference between the YMCA and.
Camp Cavell
http://www.campcavell.org/website/Welcome/programs.html
Click a Program for Information. Or scroll down the page. 8226; Kid's Summer Camp. 8226; Women's Weekends. 8226; Mother &. 8226; Famiy Fun Weekends. 8226; Senior Citizen's Getaways. A great program where kids going into 2nd grade in the fall to 17 years old. Come for a week or more and stay overnight in cabins with a great counselors while enjoying activities and making friends. Come to our Bit of Everything Camp or older kids can choose from Speciality Camps Click here for more information. For kids in ...
Camp Cavell
http://www.campcavell.org/website/Donate/wishList.html
And You Can too. Maybe you can help with the little things we need. A jar of paint, maintenance tools, copy paper! They really help keep camp going! To see a more specific supply list. That could help camp during the season. (PDF). Maybe you have some of these items in your basement or garage and would like to get a new use for them. Just drop us a line at (810) 359-2267, email us at cavell@campcavell.org or just stop by camp. Thank you so much! Gift cards from any. If you would like to make a donation.
Camp Cavell
http://www.campcavell.org/website/Welcome/prPacket.html
CAMP CAVELL is a unique environment set aside from our hectic world. It is not just a place, but rather, camp is a philosophy, a way of operating. Within the boundaries of camp, lifetime friendships are formed spanning all cultural, ethnic and social lines. CAMP CAVELL fosters the ideal that individuals from diverse backgrounds can celebrate similarities while learning to appreciate diversity. To download MORE INFORMATION on who we are and those we serve. 8226; Family Weekend Programs. 8226; Open Houses.
TOTAL PAGES IN THIS WEBSITE
18
Business Directory - Shop Local - Your Digital Hometown Marketplace - MyLocalMichigan: Your Digital Hometown Marketplace
http://www.mihubcenter.com/main-directory.html
MyLocalMichigan: Your Digital Hometown Marketplace. Check us out at:. Whether looking for gift ideas, local weather, contractors, local events . . .MyLocalMichigan.com has you covered. Shop locally in stores and online! When shopping in stores, TELL THEM MY LOCAL MICHIGAN SENT YOU. Can't find what you're looking for? And let us know. PO Box 546 Lexington Michigan 48450 810-359-7774. 3607 S. Lakeshore Lexington Michigan 48450 810-359-8859. Bellaire Motel and Lodge. Butler Bed and Breakfast. 111 S Ridge Po...
Sanilac County Michigan
http://www.sanilaccounty.org/camping.shtml
Home / Outdoor Living. Salons / Day Spas. County system consisting of four parks: Delaware Park, Evergreen Park, Forester Park, and Lexington Park. Each contains various forms of camping and recreation in rustic environments. 2353 N. Lakeshore Road, Carsonville, MI 48419. 144 Shoreline East - Port Sanilac, MI 48469. Holiday Beach Resort and Campgrounds. 420 N Lakeshore Road -Port Sanilac, MI 48469. Lexington North Shore Mobile Home Park. 5203 Main Street - Lexington, MI 48450. 4731 Van Dyke - Cass City.
Business Directory - Shop Local - Your Digital Hometown Marketplace - MyLocalMichigan: Your Digital Hometown Marketplace
http://mylocalmichigan.com/main-directory.html
MyLocalMichigan: Your Digital Hometown Marketplace. Check us out at:. Whether looking for gift ideas, local weather, contractors, local events . . .MyLocalMichigan.com has you covered. Shop locally in stores and online! When shopping in stores, TELL THEM MY LOCAL MICHIGAN SENT YOU. Can't find what you're looking for? And let us know. PO Box 546 Lexington Michigan 48450 810-359-7774. 3607 S. Lakeshore Lexington Michigan 48450 810-359-8859. Bellaire Motel and Lodge. Butler Bed and Breakfast. 111 S Ridge Po...
St. Clair County Earth Fair 2016
http://www.earthdayfair.com/event_details.html
We’re glad these exhibitors have chosen to spend Earth Day with us because they form the heart of Earth Fair. Please show your support for them by not only shopping or learning from them once a year, but all year long! Let them know you saw them at Earth Fair; they would love to hear from you! Back 2 the Wild Rehab. Blue Water Area Transit. Blue Water Audubon Society. Community Enterprises of St. Clair County. EP& J Candle Co. Friends of the St. Clair River. Fritz’s Bone Appetite, LLC. Studio in the Pines.
Michigan Dance Heritage Fall Dance Camp
http://mdh-online.org/fall
Held at Camp Cavell. Near Lexington, MI. Fall Dance Weekend 2016 September 16-18. And Dance Mistress Cathy Stephens.
TOTAL LINKS TO THIS WEBSITE
10
Business profile for campcatwalk.com provided by Network Solutions
Phone: Your business phone number. Fax: Your business fax number. Email: Your business e-mail address. The type of business you are in. Your list of brands. Products and/or services you provide. Coupons and other discount information you offer. Any other information about your business. Your hours of operation. Methods of payment you accept. If this is your Web site, you can customize your business profile from your account at Network Solutions. To edit your business profile.
campcatwalkdesignandsewingacademy.com
camp catwalk -
Sign up for our newsletter! Classes & Camps. Welcome to Camp Catwalk! February 5, 2015. WELCOME TO CAMP CATWALK. CAMP CATWALK started in the summer of 2012 as a summer camp program for children and youth in Santa Cruz. Camp Catwalk now offers fashion-oriented design, sewing and fashion drawing classes, summer camps and fashion sewing parties for children and youth, ages 7-17. We support the pursuit of fashion design as a celebration of creativity, self- expression and empowerment of youth. Our fashion se...
Summer Camp, Retreats – Guiding Young People on the Adventure of Living for Christ
Summer Camp, Retreats. Guiding Young People on the Adventure of Living for Christ. February 22, 2018. January 2018 A Season of Blessing. February 2, 2018.
Camp Caufield
Wednesday, July 28, 2010. Wednesday, April 14, 2010. Wednesday - Anything Can Happen Day! A quote from The Mickey Mouse Club! Well, Spring has sprung and we've been dealing with an assortment of allergy symptoms at home over the past two weeks. I thought that was excitement enough, but it turns out, I was wrong. More updates to come. I'm off to research cars. ;-). Friday, March 19, 2010. Big Finish to a Big Week. Gosh, I feel like I've lived a month in just the past seven days. Highlights include:. Third...
Camp Cavalier - Home
Catering to Cavalier King Charles Spaniels. Camp Cavalier has been in business since 2000 in Santa Rosa, California. We offer AKC Cavalier King Charles Spaniel puppies throughout the year,. Crate-free boarding services, AKC Stud Dog Services,. And Cavalier grooming upon request. Santa Rosa, CA. Life's Abundance Premium Pet Food. Nu-Vet Plus Vitamin Supplement - 47471. Cavalier King Charles Spaniel Club (CKCSC). American Cavalier King Charles Spaniel Club (ACKCSC). American Kennel Club/CKCS (AKC).
Camp Cavell
There are many different ways to donate. Camp Cavell 3335 Lakeshore Road, Lexington, Michigan 48450. Tele: (810) 359-2267 e-mail: office@campcavell.org. 2011-2018 Camp Cavell All rights reserve.
Camp Cavell Conservancy
Camp Caviglia Calendar
The Caviglia-Cummings-Arnold almost official website. Laquo; Older Entries. Happy Mother’s Day! Carson and Kyla eating lunch at Gilroy Gardens. Kyla Riding her big girl bike! Kyla riding her big girl bike! Garrett is our pal! Fun at Vasona Park! Fun in San Diego. Sleepy after a fun day at Legoland. Look at all the Merigolds at the Pumpkin Patch. Fenway Park, 2008. Lisa and Aaron’s trip to Boston a few years back. Fenway park was almost as cool as AT&T. Going to the zoo, zoo zoo….
Home
With 3 bedrooms, 1 bath, and a kitchen, the house comes with a dishwasher, clothes washer and drier, and a gas stove. On the Buffalo Creek. The cabin is located on an old boys camp on the Buffalo creek, 10 minutes away from nearby Lexington. The house is perfect for anyone who would like to live in the country, yet is still close to town.
Central Arkansas Youth Camp – Camp Dates July 9-14, 2017
Central Arkansas Youth Camp. Sign up of our Newsletter! Schedule, Consent and Release, and What to Bring. CAYC July 15-18, 2018. WHAT IS CENTRAL ARKANSAS YOUTH CAMP? CAYC July 15-20, 2018. We will post news, information, and articles here. Central Arkansas Youth Camp Newsletter. December 18, 2016. We won’t flood your inbox, just an occasional newsletter to encourage you and keep you up to…. CAYC July 15-20, 2018. February 4, 2018. July 4, 2017. A Call to Action. May 2, 2017. March 28, 2017.
SOCIAL ENGAGEMENT