Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you.
http://champagnewishesandcoupondreams.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
0.5 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
18
SSL
EXTERNAL LINKS
76
SITE IP
172.217.6.65
LOAD TIME
0.546 sec
SCORE
6.2
Champagne wishes and coupon dreams... | champagnewishesandcoupondreams.blogspot.com Reviews
https://champagnewishesandcoupondreams.blogspot.com
Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you.
champagnewishesandcoupondreams.blogspot.com
Champagne wishes and coupon dreams...: May 2011
http://champagnewishesandcoupondreams.blogspot.com/2011_05_01_archive.html
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Sunday, May 22, 2011. A new dinner plan. I've found a new, free menu planning site. Say Mmm. Egg flower soup and rice.
Champagne wishes and coupon dreams...: June 2011
http://champagnewishesandcoupondreams.blogspot.com/2011_06_01_archive.html
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Friday, June 17, 2011. I'll be extending that sabbatical. Can I do it? Sure Will I stick with it? 160; Hey there, Im Tor...
Champagne wishes and coupon dreams...: February 2011
http://champagnewishesandcoupondreams.blogspot.com/2011_02_01_archive.html
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Thursday, February 17, 2011. More information to share on URBAN HOMESTEAD(ing). If other attorneys show up and want to h...
Champagne wishes and coupon dreams...: More of the madness
http://champagnewishesandcoupondreams.blogspot.com/2011/05/more-of-madness.html
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Tuesday, May 3, 2011. More of the madness. But I'm making my way back. Natalie very proud of her seeds. A new dinner plan.
Champagne wishes and coupon dreams...: December 2010
http://champagnewishesandcoupondreams.blogspot.com/2010_12_01_archive.html
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Monday, December 20, 2010. Last summer, I thought that I would enjoy the Slow movement. I am looking forward to Christma...
TOTAL PAGES IN THIS WEBSITE
18
All you need is love...: Kettle Dyed :: Silver Lilac, Turquoise Brown, Light Turquoise Silver Brown
http://mrsmissymuffet.blogspot.com/2012/06/kettle-dyed-silver-lilac-turquoise.html
Friday, June 15, 2012. Kettle Dyed : Silver Lilac, Turquoise Brown, Light Turquoise Silver Brown. OOAK kettle dyed colorways on Kona Worsted Superwash yarn. I can repeat them but not exactly as I layered the colors at will. They are not hand painted colorways, they are intricate layers of colors which results in two skeins never being exactly the same. June 19, 2012 at 4:53 PM. August 14, 2012 at 10:42 PM. Knitting Patterns for Babies. It would definitely be great. :). October 4, 2012 at 4:25 AM. Merry C...
All you need is love...: Owl Chart
http://mrsmissymuffet.blogspot.com/2011/11/owl-chart.html
Monday, November 21, 2011. I based this chart on a pair of longies I knit and embellished for my son. I had lots of comments on the owl and figured it would be helpful to provide a chart for anyone who wishes to add an owl to their knit projects. I changed the owl up a bit from my original. The original owl I threw together as I stitched but the look is still the same I think. :). You will need three colors of yarn, either the same weight the garment was knit in, or one weight smaller. Thanks a lot for t...
All you need is love...: How to Wash Wool Diaper Covers (and socks!)
http://mrsmissymuffet.blogspot.com/2011/08/how-to-wash-wool-diaper-covers-and.html
Wednesday, August 31, 2011. How to Wash Wool Diaper Covers (and socks! How to Wash Wool Diaper Covers (and socks! Gather all wool to be washed. Fill sink with warm water. Add a capful (or 1/2 teaspoon) of Naturally Luxe wool wash. Place wool in water and squeeze gently to allow water to flow through the garment. Let sit in wool bath for approximately 5-10 minutes. No longer. Sitting in dirty water is not going to get your garment cleaner. Gently squeeze water out, do not wring or twist. I have several pi...
All you need is love...: Instagram: I'm addicted.
http://mrsmissymuffet.blogspot.com/2012/09/instagram-im-addicted.html
Saturday, September 22, 2012. My newest addiction is Instagram. If you'd like to follow me, I'm: melissalaurelriley. Subscribe to: Post Comments (Atom). Maine, United States. I'm Melissa, wife to my firefighter hubby Shaun and stay at home mom to five adorable boys. While our house may never be quiet or clean it will always be filled with love and laughter. View my complete profile. Melissa Rileys Knitting Patterns and Charts. Laurel Love @ Hyena Cart. Laurel Love @ Bitty Fluff. Laurel Love @ Facebook.
All you need is love...: August 2012
http://mrsmissymuffet.blogspot.com/2012_08_01_archive.html
Friday, August 31, 2012. During the summer we visit a local state park beach 1-3x's a week depending on Shaun's schedule and the weather. As summer winds down, and the tourist leave, the beach transforms from busy tourist dump to a serene wonderland. No tourist means no lifeguard. :) So we got to play on their stand. The ramp is much harder to walk up and down then you would think. Look at me and smile! That's as good as it's going to get. Going down.they always send the little one down first. Home Ecky ...
All you need is love...: September in a nutshell.
http://mrsmissymuffet.blogspot.com/2012/09/september-in-nutshell.html
Saturday, September 22, 2012. September in a nutshell. What we've been up to lately. Sept 4th was the first day school, (God bless their teachers! Logan is playing soccer. Ben is playing soccer. We are still adjusting to going from no dog.to a 70lb boxer. I've been dying yarn,. And knitting as much as possible,. And trying to soak up every second with Declan as it won't be long before he's in school and I'm forced to grow up and get a real job. October 4, 2012 at 4:16 AM. Maine, United States. Cloth Diap...
All you need is love...: The Lifeguard Stand
http://mrsmissymuffet.blogspot.com/2012/08/the-lifeguard-stand.html
Friday, August 31, 2012. During the summer we visit a local state park beach 1-3x's a week depending on Shaun's schedule and the weather. As summer winds down, and the tourist leave, the beach transforms from busy tourist dump to a serene wonderland. No tourist means no lifeguard. :) So we got to play on their stand. The ramp is much harder to walk up and down then you would think. Look at me and smile! That's as good as it's going to get. Going down.they always send the little one down first. Cloth Diap...
All you need is love...: June 2012
http://mrsmissymuffet.blogspot.com/2012_06_01_archive.html
Friday, June 15, 2012. Kettle Dyed : Silver Lilac, Turquoise Brown, Light Turquoise Silver Brown. OOAK kettle dyed colorways on Kona Worsted Superwash yarn. I can repeat them but not exactly as I layered the colors at will. They are not hand painted colorways, they are intricate layers of colors which results in two skeins never being exactly the same. Links to this post. Purple, lilac, yellow/green, light turquoise, and coral pink. Petunia on Aran BFL. Links to this post. Melissa laurel fiber artist.
All you need is love...: September 2012
http://mrsmissymuffet.blogspot.com/2012_09_01_archive.html
Tuesday, September 25, 2012. Billy's early birthday gift. Billy turns the big 1-0 in three weeks. He has a long list of stuff for us to pick what we wanted to get him for his birthday. A bike being one of them. I don't think Billy's ever had a brand new bicycle before. With the days cooling down quickly we decided to give it to him now, rather then wait another three weeks. Links to this post. Saturday, September 22, 2012. My newest addiction is Instagram. Links to this post. Links to this post. Laurel L...
All you need is love...: Colorway :: Petunia
http://mrsmissymuffet.blogspot.com/2012/06/colorway-petunia.html
Friday, June 15, 2012. Purple, lilac, yellow/green, light turquoise, and coral pink. Petunia on Aran BFL. Melissa laurel fiber artist. I love this what a great job. June 15, 2012 at 7:54 PM. I absolutely love the yarn! I saw your post earlier today and I was amazed of your work. This is absolutely a work of art. Thanks for showing us your masterpiece and for sharing such valuable information. Keep on posting. October 4, 2012 at 4:32 AM. Subscribe to: Post Comments (Atom). Maine, United States. Simple tem...
TOTAL LINKS TO THIS WEBSITE
76
Katie Page and Chris Champagne's Wedding Website
October 18, 2014. Newlyweds for 216 days! Welcome To Our Wedding Website! We are so excited to share our special day with special people. We are so thankful for the roles each of you have played in our lives and are so glad to have help us celebrate our wedding.
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
Champagne Wishes TV
Use the form on the right to contact us. You can edit the text in this area, and change where the contact form on the right submits to, by entering edit mode using the modes on the bottom right. San Francisco, California. Have you ever wanted to pick an entrepreneurs brain to find out more about being a business owner? At Champagne Wishes TV we interview entrepreneurs so that you don't have to. Our mission is to educate others about being a business owner through the experiences of business owners.
champagnewishesandcaviardreams.com
ChampagneWishesAndCaviarDreams.com is for Sale! @ DomainMarket.com, Maximize Your Brand Recognition with a Premium Domain
Ask About Special March Deals! What Are the Advantages of a Super Premium .Com Domain? 1 in Premium Domains. 300,000 of the World's Best .Com Domains. Available For Immediate Purchase. Safe and Secure Transactions. 24/7 Customer Support: 888-694-6735. Search For a Premium Domain. Or Click Here To Get Your Own Domains Appraised. Find more domains similar to ChampagneWishesAndCaviarDreams.com. We are constantly expanding our inventory to give you the best domains available for purchase! 4,300,129,042.
champagnewishesandconceptiondreams.blogspot.com
Definitely. Maybe? BABY!
On the down low:. New to the blog? Get all caught up here! Tuesday, June 28, 2011. We've had a few comments and emails about whether I'm still updating on my pregnancy and our little guy. If you didn't know already, over on my first blog, A Blue-Eyed Boy Met a Brown-Eyed Girl. You can catch up on the all the growing anticipation and excitement we've been going through over the past 8 months. Little man is almost here♥! Some of the preggers posts I've written over the last few months:. In love with a boy.
champagnewishesandcoupondreams.blogspot.com
Champagne wishes and coupon dreams...
Champagne wishes and coupon dreams. Picture this: June Clever in her kitchen. Now picture her in a pair of sweats, no shower, skipped the bra, hair a mess, two toddlers pulling at her apron, flour all over the kitchen, laundry piled up on the couch, two big kids that need a ride to practice and dinner in the crockpot. Yep, that's me. This is my attempt to share my daily chaos with you. Friday, June 17, 2011. I'll be extending that sabbatical. Can I do it? Sure Will I stick with it? Sunday, May 22, 2011.
champagnewishesandfrenchfrydreams.wordpress.com
champagnewishesandfrenchfrydreams | You're welcome.
A Strongly Worded Letter To The Bar Exam. July 5, 2014. This Is Not Your Feminist. 1) First of all, let’s talk about your stupid list of what I can bring into the bar exam. Oh my god, no sharpeners. NO SHARPENERS. Well yes, I’m sure sharpeners pose a grave security threat. I might lose my shit at seeing a Secured Transactions essay on the bar exam and threaten to sharpen someone’s pencil or something. Oh god, the sharpening! 2) Mnemonics, bitches. You give us FAR too many. The. 1,304 more words.
champagnewishesandrvdreams.com
Champagne Wishes and RV Dreams
Champagne Wishes and RV Dreams. Living the dream on the open road. Thursday, February 15, 2018. We are "wintering" at Happy Trails RV Resort in Surprise Arizona again this year for about three months. I say "about", because we haven't quite decided if we are staying an extra month not just quite yet or not.we shall see. In the mean time, as we sit back and relax, we've done a few (very few, actually) fun visits! Another fun artist was a lady who gathers together candy wrappers. I was mesmerized by them!
champagne wishes
Error Page cannot be displayed. Please contact your service provider for more details. (16).
champagnewishescaviardreams.blogspot.com
Champagne Wishes & Caviar Dreams
Champagne Wishes and Caviar Dreams. I take life with a pinch of salt . a wedge of lime and a shot of tequila! Wednesday, January 14, 2009. TOP 7 THINGS THAT WILL HAPPEN IN THE YEAR 2009. I will move back to Europe by September 2009. By Christmas 2009. (alert Vera and book that. Castle for a June 2010 wedding! I will go to Cambodia and make both Katie’s weddings in the summer of 2009, wherever they chose to tie the knot. (Try to keep it close, guys, since its only 2 weeks apart! I will forgive Singapore.
champagnewishescaviardreams.com
champagnewishescaviardreams.com
SOCIAL ENGAGEMENT