diaryofaweightwatchingwifeweeklymeals.blogspot.com
Weekly Meal Plans
A summary of all my meals and snacks in the week. Diary of a Weight Watching Wife. Everything You Might Like to Know About Me. Monday, 17 August 2015. Week 3 - The Meals. This week I tried to get busy with my low propoint snacks and lunches. I have found it a bit tricky to stay within my 26 propoints, so I decided to get creative. My favourite things to munch on this week were:. My favourite snack this week was the frozen grapes. They were lovely and really felt like a good treat. The final and absolute ...
diaryofawellie.com
diary of a wellie
Diary of a wellie. Wellie (n.): A person who aspires to live a balanced, mindful, and healthy life. Wednesday, February 5, 2014. Is sugar REALLY as bad as they say it is? Actually, it could be worse! Sugar is a very complex topic that I won't attempt to summarize here; instead, I wanted to share a couple of videos that are definitely worth watching if you want to learn more about what really happens when that cupcake hits your lips. The Skinny on Obesity- Sickeningly Sweet. Sugar: The Bitter Truth. As th...
diaryofawestsidemom.com
diaryofawestsidemom – This WordPress.com site is the cat’s pajamas
This WordPress.com site is the cat’s pajamas. The Flashy Handbag Club. June 27, 2015. July 24, 2015. CLICK HERE: WHY LOUIS VUITTON IS IN TROUBLE ARTICLE. So excited to hear on the evening news that the Washington Post has reported that luxury handbag makers are seriously worried about the trend of women disliking designer handbags. Too bad that Westside moms haven’t caught on yet. Are you tired of seeing Goyard, Celine, Hermes and Valentino bags? June 10, 2015. July 30, 2015. Of course, they are one of m...
diaryofawhimpykid.com
diaryofawhimpykid.com
Inquire about this domain.
diaryofawhimpytrader.com
Welcome diaryofawhimpytrader.com - BlueHost.com
Web Hosting - courtesy of www.bluehost.com.
diaryofawhinyguy.com
Diary Of A Whiny Guy | I Whine. I Write. And Yes, The Title Is Lame. Get Over It.
Get me outta here! Diary Of A Whiny Guy. I Whine. I Write. And Yes, The Title Is Lame. Get Over It. My name is. Well that doesn’t matter. You can call me M or The Dude (depending on whether you like James Bond or The Big Lebowski. Like every guy, I have women related problems (unless you are gay, then you just have men to deal with), have parents who wonder when I’m going to make it big in life and sponsor them a cruise to Hawaii. Nevertheless, I hope everyone has a blast reading my blog. Yeah, I could s...
diaryofawhinyguy.wordpress.com
A Diary Of A Whiny Guy | Just another random guy venting on the internet….
Get me outta here! A Diary Of A Whiny Guy. Just another random guy venting on the internet…. All Good Things Must Come To An End…. May 26, 2013. It’s with a heavy heart that I announce that EOD today, I will not be posting on this blog anymore. We had a great run, we had our good times and bad, but as the old folks say, “All good things, must come to an end”. So what’s next for me? Well, I promised myself something if I were to across 2000 hits. And I give you, *Drum Rolls*. See you all there! Well, it&#...
diaryofawhiteblackgirl.blogspot.com
diary of a white "black" girl
Diary of a white "black" girl. Monday, April 18, 2011. What is it that one looks for in life. I don't understand what I am suppose to be looking for in life or what to do. I feel like Life is some crazy test from a world beyond our ability to understand. It seems everything I am doing right now and the choices I am making are the wrong ones, or are they the right ones from another persons view? Sunday, March 27, 2011. This is not what I signed up for. Tuesday, March 1, 2011. Wednesday, February 2, 2011.
diaryofawhitekid.wordpress.com
Diary of a White Kid | The reality of life in an East End school
Diary of a White Kid. July 8, 2015 · 2:13 pm. These cuts are appalling, they are enabling wealthy people to hold on to more and more of their wealth and taking away the life line for those living in poverty and depend on the welfare state to survive. Tagged as 2015 budget. March 3, 2015 · 10:05 pm. Serena and Gone Girl, feminist works. If you know of any other books with strong female roles, then please send them my way in the comments. January 21, 2015 · 5:16 pm. This Girl Does It. I really like this ad...
diaryofawhiteunemployedwoman.blogspot.com
Diary of a White, Formerly Unemployed Woman
Diary of a White, Formerly Unemployed Woman. My name is Jayne LaFave. I graduated from Georgia State University as a double major in Spanish and philosophy in December of 2008. I was unemployed for seven months post-graduation. Now I have my first job. The only thing worse than being unemployed is pretending to be a grown-up. Thursday, May 19, 2011. Today I applied for a job at Scoutmob. What is Scoutmob you ask? Thursday, October 8, 2009. Formerly unemployed, and better than ever. I began working at Und...
