displayads.newsday.com
Cumulus
Enter your user name and password to login using your account. To connect for guest access, leave user name and password fields empty. Login for access to files published by the host of this website. Use the box to the right to connect using your user name and password. This website portal is built on Cumulus, the digital asset management solution.
displayads.org
displayads.org -
displayadsinnewspapers.com
displayadsinnewspapers.com - displayadsinnewspapers Resources and Information.
This domain has expired. If you owned this domain, contact your domain registration service provider for further assistance. If you need help identifying your provider, visit https:/ www.tucowsdomains.com/.
displayadsnow.com
Local Display Advertising
We Help You Grow Your Business and Increase Your Profits 702-289-4271. Call Us Today at 702-289-4271. Digital Display Ads Grow your Business and Profits! For More Information Call Us! RAPIDLY BOOST BRAND VISIBILITY. We make it easy to get 100 s of thousands of targeted impressions within 15 miles of your business. We target your ideal prospects and customers based on location, demographics, interests and intentions. NEW LEADS and BUSINESS GROWTH. Distribution on all major ads networks. Targeted display a...
displayadtech.com
Display Adtech
Ad Tech Companies List. View Ad Tech Companies List Below. Sovrn Holdings, Inc. Association of National Advertisers. Goodby, Silverstein and Partners. DJAX Adserver Technology Solutions. Are You a Human. Sign into Display AdTech. Sign in with Linkedin. Sign in with Facebook. Don't have an account? To contribute, profile must be connected with LinkedIn.
displayadvertise.com
displayadvertise
Best value for advertisers and publishers. Mdash; an innovative marketplace where advertisers get highest results and publishers monetize their valuable traffic! Our professional approach, latest internet marketing techniques and advanced technologies are at your disposal for reaching your ambitious goals. Benefit from the great opportunity to promote your sites, products and services to a wide audience of potential customers. Advantages to be our Advertiser:. Precisely target your ad.
displayadvertisement.com
displayadvertisement.com -
displayadvertisements.com
Display Advertisements - Local Display Advertisements
MyLocalzz - 200 Sites. Enter Topic and City, State. Enter Topic and City, State. Owned and Operated by. Display Advertisements - Featured. Localzz 200 Specialty Sites. Northland 200 Specialty Sites. Northwoods 40 Specialty Sites. Counties (CO) Cities (CI). Also check out SavingsLand.com. Also check out CouponCEO.com. Topic and Local Sponsored General Ads. Limited Time Ads -. Daily, Weekly, Monthly or more. Sponsored Ads - Display Ads. Sponsored Text Link Ads. Check out SavingsLand.com. 25 Dollar Advertis...
displayadvertising.digitalmarketingmagazine.com
digitalmarketingmagazine.com - This website is for sale! - digitalmarketingmagazine Resources and Information.
The domain digitalmarketingmagazine.com. May be for sale by its owner! This webpage was generated by the domain owner using Sedo Domain Parking. Disclaimer: Sedo maintains no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo nor does it constitute or imply its association, endorsement or recommendation.
displayadvertising.hotwirepersonals.com
Display Advertising Hot Wire Personals
Hot Wire Personals is offering advertisers a variety of ad formats across multiple devices. Our design team is continuously upgrading the site and adding new ad formats, so check back regularly to be informed. Please note these formats are the same for both Hot Wire Classifieds and Hot Wire Personals. Mobile Banner Wide 320x100. Mobile Super Billboard 320x120. Home, Search Results and View Item Pages. Mobile Banner Wide 320x100. Home, Search Results and View Item Pages. Mobile Super Billboard 320x120.
displayadvertising.info
displayadvertising.info
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).