drivingschoolscheduler.com
Welcome to DanubeNet: small business specialistsDanubeNet provides web based applications to small bussnises. From real estate companies to movers, driving schools, and associations.
http://www.drivingschoolscheduler.com/
DanubeNet provides web based applications to small bussnises. From real estate companies to movers, driving schools, and associations.
http://www.drivingschoolscheduler.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
16x16
Petrov, Anatolij
82 E. Cl●●●●●●●●t Apt 11
Som●●●lle , NJ, 08876
US
View this contact
Petrov, Anatolij
82 E. Cl●●●●●●●●t Apt 11
Som●●●lle , NJ, 08876
US
View this contact
Petrov, Anatolij
82 E. Cl●●●●●●●●t Apt 11
Som●●●lle , NJ, 08876
US
View this contact
Petrov, Anatolij
82 E. Cl●●●●●●●●t Apt 11
Som●●●lle , NJ, 08876
US
View this contact
BUY YOUR DOMAIN
OMNIS NETWORK, LLC
WHOIS : whois.omnis.com
REFERRED : http://domains.omnis.com
PAGES IN
THIS WEBSITE
5
SSL
EXTERNAL LINKS
6
SITE IP
216.239.138.189
LOAD TIME
0 sec
SCORE
6.2
Welcome to DanubeNet: small business specialists | drivingschoolscheduler.com Reviews
https://drivingschoolscheduler.com
DanubeNet provides web based applications to small bussnises. From real estate companies to movers, driving schools, and associations.
drivingschoolscheduler.com
Driving School Scheduling Driving School Software
http://www.drivingschoolscheduler.com/Driving_School_Scheduling.html
Scheduler v2.0 is a web based product specifically designed for driving schools. Scheduling has never been easier. Both You and your entire office can share side-by-side schedules for driving appointments, view daily and weekly schedules, concurrently view student, instructor and vehicle availability, assign area coverage, view and create business reports, and many more other features. Student Scheduling is Just a Click Away! Instructor and Student Availability: Conflict Proof. Student search capability ...
DanubeNet [products]
http://www.drivingschoolscheduler.com/Products-Driving-Test.htm
To see test samples. Or to open new account. Visit www.myeform.com. Setup is FREE and we offer 30 day FREE account, and Buy 1 Get 1 Free Test Offer. DanubeNet offers an Online Driving Test. Specifically tailored for driving schools. Tests are fully customizable through our web based control panel. Once you signup, pre filled test will be available to you immediately, and you can either attached them to your web site or send them directly to your students and clients.
DanubeNet [mover web package]
http://www.drivingschoolscheduler.com/Products-Mover-Website.htm
FREE 6 Month Web Hosting! FREE 3 Month Form Subscription SAVE$75. FREE 6 Month Web Hosting! FREE 6 Month Forms Subscription SAVE$240. FREE 12 Month Web Hosting! FREE 6 Month Forms Subscription SAVE$240. Our packages are not limited to the plans listed above. If you need different pages for your web site we can easily accomodate you. All of the plans include OnlineEstimate Form which will be integrated into your design, so the form will have the feel and look of your web site. Digital pictures at your site.
DanubeNet [driving school web package]
http://www.drivingschoolscheduler.com/Products-Driving-Website.htm
Our packages are not limited to the plans listed bellow. If you need different pages for your web site we can easily accomodate you. All of the plans include Online Driving Test. Which will be integrated into your design. Additional HTML Pages . Additional Animated Graphics . Flash Introduction Design . Digital pictures at Your Site (NJ Only) . Create Adobe PDF Format pages .
DanubeNet [mover estimate form]
http://www.drivingschoolscheduler.com/Products-Mover-Estimate.htm
DanubeNet offers OnlineEstimate Form specifically designed for residentail and office movers. By simply adding link to your existing web site you can receive detailed estimate requests from your potential clients. OnlineEstimate Form will be sent to you and your client via E-mail. Your client can fill out content of their household or office. Volume and weight will be calculated autimatically. Once they are finished they will submit the request and it will be sent to you and your client via e-mail.
TOTAL PAGES IN THIS WEBSITE
5
Navigator Driving Academy
http://www.navigatordriving.com/index.html
Adult Behind The Wheel. Road Skills Test Prep. Adult Behind The Wheel. Road Skills Test Prep. Click Here for Schedule. Click Here to Enroll Now. Click Here for Schedule. Click Here to Enroll Now. Click Here to Enroll Now. 9 am - 3 pm. Toll Free: (888) 866-8520. Click here to take FREE knowledge test! 2011 Powered by DrivingSchoolSoftware.com.
Navigator Driving Academy
http://www.navigatordriving.com/faq.html
Adult Behind The Wheel. Road Skills Test Prep. Adult Behind The Wheel. Road Skills Test Prep. What is the minimum age that my teen can start driver's training? Answer - They can start taking the class at 14 years, 8 months. When they get their certificate of completion, they have to be 14 years, 9 months to turn it in to the Michigan Secretary of State and get their Level One license. Why 24 hours for Segment One? When do I need to pay for the class? What if my son/daughter misses a class? Answer - The s...
Navigator Driving Academy
http://www.navigatordriving.com/services.html
Adult Behind The Wheel. Road Skills Test Prep. Adult Behind The Wheel. Road Skills Test Prep. Road Skills Test Prep Review. 1 Students must be at least 14 years 8 months old by the first day of class. 2 Students must pass a vision test. Visual acuity is at least 20/40 corrected for an unrestricted driver license. 3 Students must provide a birth certificate or passport so we can verify their date of birth. 24 Hours of Classroom. 6 Hours of Driving. Drive 1: Low traffic, braking, accelerating and turning.
Navigator Driving Academy
http://www.navigatordriving.com/about.html
Adult Behind The Wheel. Road Skills Test Prep. Adult Behind The Wheel. Road Skills Test Prep. Why Choose Navigator Driving Academy? We can all remember the feeling: that combination of adrenaline and excitement as we slid behind the wheel in our first Driver's Education class. Earning a license is a rite of passage for most teens, but not everyone has good memories of how they reached that milestone. As Driver's Education instructors, people often ask us with a wry smile, Oh, how can you do that?
Navigator Driving Academy
http://www.navigatordriving.com/testimonials.html
Adult Behind The Wheel. Road Skills Test Prep. Adult Behind The Wheel. Road Skills Test Prep. Thank you for accomodating my schedule. Many driving schools wouldn't have done that for me. I enjoyed the class and thought very highly of both of you. I wish you the best of luck this upcoming spring and summer with classes and just life in general. PS: Mrs. Musil, thanks for taking me to Jody's. I appreciate it, in addition to our wonderful chats in the car! My friends were looking at price when deciding on a...
TOTAL LINKS TO THIS WEBSITE
6
Driving Lessons in Cambridge | Home Page
I am an affordable driving instructor working throughout Cambridge and the surrounding areas. One to One Tuition, Starter Lessons, Refresher Courses, Intensive Driver Training, Pass Plus and more. Affordable Driving Instructor in Cambridge. I offer professional one to one driving tuition at affordable prices. If you are looking to start learning or already have a little knowledge then get in touch! Driving Lessons In Cambridge. Call us on 07795 955 105 for more information on how we can help you.
Account Suspended
This Account has been suspended. Contact your hosting provider for more information.
drivingschoolscanberra.com.au
Want this domain name? Contact the owner direct. The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
drivingschoolscarborough.co.uk
One on One Driving Tuition - Driving School Scarborough
Or Text 'Lessons' to 07939 041611. Or Email: mick.howell56@gmail.com. Welcome to One on One - Driving Tuition. Friendly, qualified and experienced driving instructor. Covering Scarborough, Filey and Pickering. Learning to drive can be a daunting experience but with One on One. We'll be there, with you every single step of the way. Book Your Lessons Now. First Lesson Only 24.00. Mick is a first class driving instructor! I would recommend Mick without hesitation, as an excellent driving instructor. Thanks ...
Homepage - Driving Lessons Carlisle
Guaranteed Pass Course Carlisle. Intensive Driving Course Carlisle. Refresher Driving Lessons Carlisle. Theory Test Training Carlisle. Driving Mock Test Carlisle. Pass Plus Course Carlisle. Show Me Tell Me. Practical Driving Test Explained. Area’s We Cover. PASS YOUR DRIVING TEST FIRST TIME. GUARANTEED PASS DRIVING COURSE. Are you looking for Driving Lessons Carlisle. Perhaps your fed up with public transport or just looking for a new found freedom or even that job a promotion! Whatever the reason is we ...
Welcome to DanubeNet: small business specialists
Online Quizes for Schools. Web Based Estimate Forms.
Welcome to DanubeNet: small business specialists
Online Quizes for Schools. Web Based Estimate Forms.
iDomains ltd - Website Hosting Lapsed - tel: 01229 840262
Website suspended due to hosting lapse.
drivingschoolschestercountypapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
drivingschoolschicago.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
drivingschoolscleethorpes.co.uk
One Way Driving School | Expert driving instructor in Cleethorpes
Beginner to Instructor level driver training - Call 07881 77 87 15. Cleethorpe's premier driving school! Show me / Tell me. Expert driving tuition for Cleethorpes. One Way Driving School are here in Cleethorpes ready to take your driving to the next level. It doesn't matter if you have never driven before or if you want to train to be a driving instructor, we have got you covered. Customized courses to suit your needs. A modern approach to driving lessons. A range of driving lesson options:. Operating in...
