Abracadabra Driving School based in Dundee offers driving tuition only by a fully qualified approved driving instructor (ADI). Dundee, Scotland, Angus, Perthshire
http://www.drivingschoolsdundee.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
0.4 seconds
16x16
Charles J Mullan
First ●●●●●● Right
14 Baxt●●●●●●●Terrace , Dundee, DD4 6NW
UNITED KINGDOM
View this contact
M247 Limited
Domain Name Manager
Bal●●●een
Cobr●●●●ourt
Str●●●ord , Manchester, M32 0QT
UNITED KINGDOM
View this contact
M247 Limited
Domain Name Manager
Bal●●●een
Cobr●●●●ourt
Str●●●ord , Manchester, M32 0QT
UNITED KINGDOM
View this contact
BUY YOUR DOMAIN
17
YEARS
5
MONTHS
8
DAYS
CSL COMPUTER SERVICE LANGENBACH GMBH D/B/A JOKER.COM
WHOIS : whois.joker.com
REFERRED : http://www.joker.com
PAGES IN
THIS WEBSITE
9
SSL
EXTERNAL LINKS
0
SITE IP
89.238.188.29
LOAD TIME
0.384 sec
SCORE
6.2
Abracadabra Driving School Dundee | Home | drivingschoolsdundee.com Reviews
https://drivingschoolsdundee.com
Abracadabra Driving School based in Dundee offers driving tuition only by a fully qualified approved driving instructor (ADI). Dundee, Scotland, Angus, Perthshire
drivingschoolsdundee.com
Abracadabra Driving School Dundee| Pass Plus
http://www.drivingschoolsdundee.com/passplus.html
Statistics show that new drivers are more likely to have an accident in the first two years of passing their driving test due to a lack of driving experience - this is where Pass Plus comes in! Pass Plus is a training course designed by the Driver and Vehicle Standards Agency (DVSA). Pass Plus is made up of six practical modules which include:. Driving in all weathers. Driving on rural roads. Driving on dual carriageways. How much does Pass Plus cost? PASS PLUS COURSE 6 Hours (Includes Refreshments).
Abracadabra Driving School Dundee| Automatic Car Lessons
http://www.drivingschoolsdundee.com/automatic_driving_lessons.html
Not everyone wants to learn to drive in a manual car. Abracadabra Driving School can offer automatic driving lessons in Dundee. Why make life difficult for yourself? Driving an automatic car will still get you to where you want to go but with safer and easier driving. If you are having difficulties in managing the gears in a manual car you may find that learning in an automatic car will be the right choice for you. Automatic cars used to be less reliable and less fuel efficient but technology is now far ...
Abracadabra Driving School Dundee| Links
http://www.drivingschoolsdundee.com/links.html
Driving Standards Agency (DSA) -. Institute of Advanced Motorists (IAM) -. Blue Light Aware -. 2 Young 2 Die -.
Abracadabra Driving School Dundee| Vouchers
http://www.drivingschoolsdundee.com/vouchers.html
The Perfect Gift Idea. If you know somebody who wants to learn to drive but are not sure when they want to start or a birthday is coming up and you want to buy a present instead of giving cash, why not buy a Driving Lessons Gift Voucher? We can issue vouchers for any amount of lessons and the voucher is valid for up to 6 months. Another advantage of the voucher scheme is that once you have paid for these lessons, the price remains fixed and cannot increase in price. Prices Correct As At 01/04/2016.
Abracadabra Driving School Dundee| Testimonials
http://www.drivingschoolsdundee.com/testimonials.html
Hi Charlie, thank you for all your expert tuition, couldn’t have done it without you. Danny. Hi Charlie just wanted to say thanks for everything,. I really enjoyed learning with you, take care. Emma. Hi Charlie thanks very much for the instruction,. You have been great to learn with,. Thanks again for everything. Michael. Hi Charlie thank you very much, that’s me done over 200 miles in Dad’s car already, thank you again. Ross. Felt great, thanks for all your help. Dannii.
TOTAL PAGES IN THIS WEBSITE
9
Graham's Driving School | Driving School in Crawley
I had a great time and lots of fun learning to drive with Graham. He is very professional and relaxed in the way he teaches each lesson and i passed first time and would recommend him anytime. I was a complete novice but being a lad knew a bit about cars but Graham went through things in detail and involved me alot which is great and i learned quickly each lesson and succeded on passing 2nd time which was great. Top bloke and worth every penny! Welcome to Graham's Driving School. Driving school in Crawley.
drivingschoolsdelawarecountypapennsylvaniastickshiftclasses.com
Driving School, Driving Lessons | Pennsylvania
Where Safe Drivers Are Born Since 1976. Driving Lessons in The Delaware Valley. All PA Suburbs of Philadelphia and The Entire City. We make Driver's Ed a pleasent experience. Learning how to drive well and with confidence is an easy skill that can be taught. CONFIDENT DRIVING SCHOOL. Offers affordable and professional driving lessons that help you get your license. Learn how to drive confidently at our driving school. Us for our behind the wheel and online driver education classes. Driving You to Success.
Driving Schools Derby
Driving Schools Derby 07989 588712. The driving lessons will be set to the pupil’s standards and will allow the learner to progress quickly at a level that suits them. I will teach them to be a safe driver for life. For tuition from a professional come to G Force School of Motoring. You will learn to handle all weather and road conditions so that in addition to driving competently under normal conditions, when a difficult situation arises, you have the knowledge and experience to take it in your stride.
drivingschoolsdirectory.info - Crazy Domains
Search and register domain names. World's cheapest domain names. 700 New generic domains. Move your domains to us FREE. Express cheap domain renewal. Get the domain name you want. Everything you need for your domains. Control your CNAME, MX and A records. Find who owns a particular domain. COM only $9.00 Get yours! Join The Domain Club. Fast, reliable space for your website. Defend your site against hackers. Secure your site and data. Get your own me@mydomain.com. Automatic Spam and Virus protection.
Home - Jason Pain Driving School
Jason Pain Driving School Dover. Pass With Jason Pain Driving School. Welcome to Jason Pain Driving Schools Dover. We offer Driving Lessons in Dover. Driving lessons in Deal and driving lessons in Folkestone, as well as the surrounding areas. We also offer Intensive Driving Courses. And the Pass Plus Course. For when you have passed your test. We can pick you up at any address in the local area. We have over 15 years teaching experience in the local area using Grade-A Instructors. Call Jason Pain Driving.
Abracadabra Driving School Dundee | Home
Call us on: 07745 044612. Defensive Driving / Refresher Course. Not Sure What’s Right For You? Is an independent driving school offering solely automatic. Driving lessons in Dundee, who can provide driver training from beginner to advanced level. At Abracadabra Driving School your driving instructor has the following qualifications/memberships. Is an independent driving school offering solely automatic. Driving lessons in Dundee. Visit our dedicated website. Date of last update: 01/04/2017.
Driving Schools Durham, Durham Driving Schools, My Way School of Motoring
Tel: 0784 320 0314. Welcome to Driving Schools Durham. With an outstanding first time pass rate, many years of experience, and a course structured to meet individual requirements, Driving Schools Durham has built an excellent reputation based on the satisfaction of hundreds of happy pupils time and time again. GET UP TO SPEED. Welcome to Driving Schools Durham. It is important to remember that learning to drive is not a race, and that we are here to invest time into ensuring that you pass when you are re...
Driving School Seaford. Lessons in Seaford. Seaford Learner Driving School, Buckle-up School of Motoring. Tony Willer.
Your browser does not support frames. Please visit here.
hibu
This site was purchased through our premier business store. Check it out today! Hibu is here to help consumers find local businesses, browse products. And services and buy locally. With a broad range of digital services on offer, hibu can help small. Businesses compete in the online world in next to no time at all. Together, we can help communities thrive. Discover solutions that are easy. To use and knowledge to help your business thrive. Try our products for free. Promote your business today.
California Driving School Online Seminar | CA Continuing Education For Driving School
Expand your knowledge of California Driving Laws and Rule of the Road. The latest developments in teaching techniques. Engaging and updated course materials.No hidden fees ever. Welcome to DrivingSchoolSeminar.com. California Driving Instructor and Operator Continuing Education Certification made easy! Enroll now for three simple online or audio read-along seminars that make it easy for you to:. Bypass DMV Instructor and Operator license renewal testing. Increase your personal driving skills. Re-testing ...
Professional Driving Schools in Epsom : Success Driving School
06 - Nov - 2012. Driving Schools in Epsom. Learn to drive in a Audi A1 with a fully qualified driving instructor with a high pass rate. Patient and friendly driving instructors who are fully CRB checked. We welcome students of all abilities - including nervous drivers and drivers requiring refresher lessons. We cover Epsom, Ewell, Sutton, Chessington, Tolworth, Banstead, Cheam, Worcester Park, Surbiton, Ashstead, Tadworth and Leatherhead. Driving Schools - Instructor SW6. Learn to drive with Success Driv...
