We are a Toastmasters club located in Spring, TX focusing on helping members improve their public speaking and leadership skills. We meet every Wednesday morning at 7:30 pm for 1 hour at Denny's at Cypresswood & I45
http://www.franklyspeakingtoastmasters.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
Frankly Speaking Toastmasters Club
Marcie Fessler
22702 A●●●●●●●ley Dr.
Sp●●ng , Texas, 77389
US
View this contact
Frankly Speaking Toastmasters Club
Marcie Fessler
22702 A●●●●●●●ley Dr.
Sp●●ng , Texas, 77389
US
View this contact
Frankly Speaking Toastmasters Club
Marcie Fessler
22702 A●●●●●●●ley Dr.
Sp●●ng , Texas, 77389
US
View this contact
BUY YOUR DOMAIN
GoDaddy.com, LLC (R91-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
4
SSL
EXTERNAL LINKS
1
SITE IP
0.0.0.0
LOAD TIME
0 sec
SCORE
6.2
Frankly Speaking Toastmasters Club | franklyspeakingtoastmasters.org Reviews
https://franklyspeakingtoastmasters.org
We are a Toastmasters club located in Spring, TX focusing on helping members improve their public speaking and leadership skills. We meet every Wednesday morning at 7:30 pm for 1 hour at Denny's at Cypresswood & I45
franklyspeakingtoastmasters.org
Club Calendar - Frankly Speaking Toastmasters Club
http://www.franklyspeakingtoastmasters.org/calendar.html
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. Did you forg...
Downloads - Frankly Speaking Toastmasters Club
http://www.franklyspeakingtoastmasters.org/downloads.html
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. A login key ...
Meet Our Members - Frankly Speaking Toastmasters Club
http://www.franklyspeakingtoastmasters.org/meetourmembers.html
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. Click here t...
Meeting Information / Directions - Frankly Speaking Toastmasters Club
http://www.franklyspeakingtoastmasters.org/directions.html
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. The club num...
TOTAL PAGES IN THIS WEBSITE
4
About - Pro Box, Inc.
http://www.proboxinc.com/home/about
Pro Box, Inc. In early 2009, Pro Box expanded its products to include DNV designed offshore containers. Pro Box now offers a full line of offshore DNV rated and DNV/ISO rated containers, all built to DNV 2.7-1 specifications, certified by Lloyds. Founder and CEO - Steve McVille: Biography. After earning his Bachelors in Business and while employed at Care Shipping, he agreed to a transfer to Houston where eventually he started Pro Box, Inc. in 93. Owner at Pro Box, Inc. 1993 - Present (19 years)-. In ord...
TOTAL LINKS TO THIS WEBSITE
1
FranklySpeaking - Technology Podcast from Microsoft Australia
Technology Podcast from Microsoft Australia. FS130: Happy Anniversary Windows, Ninja Cats and Andrew admits to cheating on Mikey. Posted by Andrew Coates. 12 August 2016, 11:50 am. The story of the Microsoft Ninja Cat. Https:/ blogs.msdn.microsoft.com/oldnewthing/20160804-00/? Sex, Circuits and Deep House. Http:/ www.bunniestudios.com/blog/? Visions of the Future. Http:/ www.jpl.nasa.gov/visions-of-the-future/. FS130: Happy Anniversary Windows, Ninja Cats and Andrew admits to cheating on Mikey. Zenbo ...
franklyspeakingseminars.wordpress.com
That's A Frank thought!!! – Speaking FRANKly About The Issues Of Life
That's A Frank thought! Speaking FRANKly About The Issues Of Life. A Degree in Life. Continue reading →. So You Want To Be First. Continue reading →. A Square Peg In A Round Hole. Continue reading →. Don’t Be Fooled by Life. Continue reading →. Jack of All, Master of None. Continue reading →. A Mark Not That Can’t Be Removed. Continue reading →. Continue reading →. Continue reading →. It’s All Preference. Continue reading →. Join 4,379 other followers. Blog at WordPress.com.
Frankly Speaking
Paula H. Frank, owner. Food Scientist, Technical Communicator. As an accomplished writer and food scientist with many years of practical food-industry experience in quality management and product development, I can readily interpret and deliver your technical writing and documentation needs.
Frankly Speaking – The Truth About Education in a Globalized and Connected World
The Truth About Education in a Globalized and Connected World. Five Vital Characters in the Harry Potter Books. On June 20, 2016. One of the most popular book series turned to a movie series ever is Harry Potter, known in the Wizarding World as The Boy Who Lived. While as the title character Harry is deeply involved in the plot, he is certainly not the only one that keeps the story moving. These five wizards played integral parts in the Harry Potter series:. Hagrid: This gentle giant was given the respon...
franklyspeakingtoastmasters.org
Frankly Speaking Toastmasters Club
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. Through its ...
Coming Soon - Future home of something quite cool
Future home of something quite cool. If you're the site owner. To launch this site. If you are a visitor. Please check back soon.
franklyspeakingtoo.blogspot.com
Frankly Speaking Too
Thursday, June 20, 2013. Teacher/Parent Appreciation: Class Projects. Here are a pair of projects that I used this year for my daughter's class. I took a few chalkboards to school and took two photos of each child: one telling what their favorite subject their teacher taught them and one telling what they want to be when they grow up. I used the first for teacher appreciation week. I printed this as an 11x14 and framed it. Fun little keepsakes for both the parents and the teachers! Tuesday, June 18, 2013.
franklyspeakingtv.wordpress.com
FranklySpeakingTV | Just another WordPress.com weblog
Verizon and Google Working on Tablet. May 12, 2010 at 5:36 pm. Google Book Store Coming Soon. May 5, 2010 at 6:36 pm. Apple Sold A Million iPads. May 3, 2010 at 6:43 pm. Is it Worth Getting the Ipad 3g? April 30, 2010 at 1:10 pm. New Call of Duty to be Unveiled Friday. It won’t be easy but the COD franchise has yet to disappoint. I’m sure with the release of this new Call Of Duty it won’t be any different. April 29, 2010 at 2:52 pm. Gizmodo Editor in Hot Water. April 27, 2010 at 3:52 pm. Watch Frankly Sp...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot
Remixing, remaking, and recycling great vintage imagery. Sunday, November 20, 2011. And on this day.88 years ago! Morgan, the child of two former slaves, was born in Kentucky. In 1877. When he was just 14 years old, he moved north to Ohio. Links to this post. Tuesday, November 8, 2011. Here Come the Holidays! Vintage images can be so much fun for the holidays! And, we admit it, poke a little fun at some of the goings-on of the festive season! You do know what a bundt is, don't you? When we found these ol...
franklyspeakingvintagegreetings.com
HomeFrankly Speaking Vintage Greeting Cards
Our greeting cards pair up nostalgic images with fun quotes for a modern, quirky style! Retailers can buy most items in sets of 3 or 6 with just a $50 minimum. See details on the Wholesale page. FRANKLY SPEAKING VINTAGE GREETINGS! Mom and Dad Day.
SOCIAL ENGAGEMENT