
FUNMONEYMOM.COM
Fun Money Mom - Fun, Family and Frugal Finds For The Modern MomFun, Family and Frugal Finds For The Modern Mom
http://www.funmoneymom.com/
Fun, Family and Frugal Finds For The Modern Mom
http://www.funmoneymom.com/
TODAY'S RATING
#410,825
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
2 seconds
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
216
SITE IP
65.18.121.242
LOAD TIME
1.984 sec
SCORE
6.2
Fun Money Mom - Fun, Family and Frugal Finds For The Modern Mom | funmoneymom.com Reviews
https://funmoneymom.com
Fun, Family and Frugal Finds For The Modern Mom
10 Things You Do Differently When You Have A Second Child - Fun Money Mom
http://funmoneymom.com/just-a-little-fun/10-things-you-do-differently-when-you-have-a-second-child
Fun, Family and Food For The Modern Mom. Crafts & Games. Home & Garden. DIY & Decor. St Patrick’s Day. 8220;How To”. Health & Beauty. Link Parties I Love. 10 Things You Do Differently When You Have A Second Child. August 14, 2015. I don’t have to tell you that when you have a baby, your life changes completely! Why would she eat for the “food therapist (yes, there is such a thing) and not for us? Should I take her to the doctor with a temperature of 99.7? Worry, worry, worry! When I found out I was pregn...
Meal Plan Monday Challenge #4 (Slightly Closer To Success) - Fun Money Mom
http://funmoneymom.com/meal-planning/meal-plan-monday-challenge-4
Fun, Family and Food For The Modern Mom. Crafts & Games. Home & Garden. DIY & Decor. St Patrick’s Day. 8220;How To”. Health & Beauty. Link Parties I Love. Meal Plan Monday Challenge #4 (Slightly Closer To Success). August 3, 2015. I am very happy to report that I did NOT have any epic meal plan failures this week! Here’s how I did…. The second night I made these Easy Chicken Fajitas. I mostly stuck to the plan with the kids meals. They LOVED the Buitoni Chicken and Proscuitto Tortelloni and asked for...
Recipes Archives - Fun Money Mom
http://funmoneymom.com/category/recipes
Fun, Family and Food For The Modern Mom. Crafts & Games. Home & Garden. DIY & Decor. St Patrick’s Day. 8220;How To”. Health & Beauty. Link Parties I Love. Birthday Goody Bags That Will Make The Parents Happy Too. November 2, 2016. Tired of filling your child’s birthday goody bags with cheap trinkets? These are the goody bags that will make everyone happy! Read More ». Filed Under: Gift Giving. Candy Corn Halloween Bark. October 24, 2016. Here I go again! Read More ». October 14, 2016. Read More ». If so,...
Disclosure - Fun Money Mom
http://funmoneymom.com/disclosure
Fun, Family and Food For The Modern Mom. Crafts & Games. Home & Garden. DIY & Decor. St Patrick’s Day. 8220;How To”. Health & Beauty. Link Parties I Love. Thanks so much for your support if you do make purchases through these affiliate links. This blog does not share personal information with third parties nor do I store any information about your visit to this blog other than to analyze and optimize your content and reading experience through the use of cookies. Learn How You Can Make $ On Twitter.
Gift Giving Archives - Fun Money Mom
http://funmoneymom.com/category/gift-giving
Fun, Family and Food For The Modern Mom. Crafts & Games. Home & Garden. DIY & Decor. St Patrick’s Day. 8220;How To”. Health & Beauty. Link Parties I Love. Birthday Goody Bags That Will Make The Parents Happy Too. November 2, 2016. Tired of filling your child’s birthday goody bags with cheap trinkets? These are the goody bags that will make everyone happy! Read More ». Filed Under: Gift Giving. Best Buy’s Holiday Shopping Event & My Favorite Tech Toys. October 27, 2016. Read More ». October 17, 2016.
TOTAL PAGES IN THIS WEBSITE
20
Eating Healthy on a Budget Series – Adventures in Mindful Living
http://www.adventuresinmindfulliving.com/mindful-recipes/eating-healthy-on-a-budget-series
Adventures in Mindful Living Mindfully changing the world. The 6 Week Transformation. Saving & Making Money. Eating Healthy on a Budget Series. Blogging tips & tricks. Tips and tricks for an easier life. Products that make life easier or better! Unit Studies Page -lots of unit study fun! Books these moms love. Kids Books We Love. Kid Friendly Places We Have Been and Love. I’m New- Now What? Friends and Family Call. How to set up your Business Folder. How to become a Customer Care Extraordinaire! If you w...
Make it healthier! – Adventures in Mindful Living
http://www.adventuresinmindfulliving.com/make-it-healthier
Adventures in Mindful Living Mindfully changing the world. The 6 Week Transformation. Saving & Making Money. Eating Healthy on a Budget Series. Blogging tips & tricks. Tips and tricks for an easier life. Products that make life easier or better! Unit Studies Page -lots of unit study fun! Books these moms love. Kids Books We Love. Kid Friendly Places We Have Been and Love. I’m New- Now What? Friends and Family Call. How to set up your Business Folder. How to become a Customer Care Extraordinaire! Ranch Dr...
Must Read Books for August - Pink Heels Pink Truck
http://www.pinkheelspinktruck.com/must-read-books-for-august
Pink Heels Pink Truck. A Life-Inspired Space that encourages women to try something new. BOSS GIRL CREATIVE PODCAST. BOSS GIRL CREATIVE PODCAST. DISCLOSURE & CONTENT USES. GIVEAWAY TERMS & CONDITIONS. August 10, 2015. Must Read Books for August. This post may contain affiliate links. Purchasing through them help support this website. How many of you have finished up your To-Be-Read list for Summer? But it doesn’t stop me from sharing some new reads that I’m adding to my list! The Internet isn’t all cat v...
Mexican Beef Taco Lettuce Wraps Recipe
http://homecookingmemories.com/mexican-lettuce-wraps-recipe
Celebrations & Holidays. Tips & Ideas. You are here: Home. Mexican Beef Taco Lettuce Wraps Recipe. Mexican Beef Taco Lettuce Wraps Recipe. July 1, 2015. Make taco night healthier for your family with this easy Mexican Beef Taco Lettuce Wraps recipe. The lean ground beef is cooked with onions, sweet peppers, and a homemade taco seasoning. Spoon into butter lettuce and add your favorite taco toppings. Disclosure: This Beef Taco Lettuce Wraps recipe is part of a sponsored post for Laura’s Lean Beef. And I&#...
Mother's Day without Mom- Country Mouse City Spouse
http://countrymousecityspouse.com/mothers-day-without-mom
FREE Freezer Cooking Cookbook. Learn the Biggest Mistake You Are Making When Cleaning Your Home. 6 Steps to Finally Get Your Digital Photos Organized. Master Organizing Your Thread With This One Tool. Three Great Reasons To Declutter Today. My Daily Cleaning Routine with Free Printables! DIY Pottery Barn Inspired Toilet Bowl Cleaner. Keeping a Clean House When You Don’t Have Time! Opposites Attract: When You Don’t Have Many Common Interests. Three Reasons to Start Using Yummly Today. DIY Fabric Flower Tu...
Survival Gear Archives | Special Needs Survival
http://specialneedssurvival.com/category/survival-gear
Survival, Defense, Preparation. Top 5 Outdoor Survival Gadgets to Consider For Special Needs. Surviving in any outdoor situation means that you have to have the gadgets that can help you. While there are many tools available that offer to help ensure survival, there are five top gadgets that no one should be without – special needs, or not. These are all items that contribute to your safety and […]. Click to share on Facebook (Opens in new window). Click to share on Pinterest (Opens in new window). Click...
Container Gardening Works With Physical Disability | Special Needs Survival
http://specialneedssurvival.com/shelter/container-gardening-works-with-physical-disability
Survival, Defense, Preparation. Why You Should Try Container Gardening. Has become a lot more popular in recent years, there are still so many people who aren’t doing it. I just don’t know why – there so many benefits compared to traditional gardening. Kids Enjoy Container Gardening. Container gardening is also a great way to teach children how to grow and care for plants. With traditional gardening there is much more involved and children can become bored and lose interest, but with container garden...
livesimplylivethriftylivesavvy.com
FREE 11X14 Photo Canvas from Canvas People | Live Simply, Live Thrifty, Live Savvy
http://livesimplylivethriftylivesavvy.com/2015/06/02/free-11x14-photo-canvas-from-canvas-people
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! FREE 8 10 Walgreens Photo Print Just in Time for Mother’s Day. Having a Pet Can Be Expensive Here Are Some Cheats! FREE 11X14 Photo Canvas from Canvas People. The perfect Father’s Day gift for Dad! Looking for the perfect gift for dad? I have it right here just in time for Father’s Day. Just pay shipping. Or you can get 60% off other canvas sizes. Offer Details: Offer expires.
Do You Notice The Survival Warnings? | Special Needs Survival
http://specialneedssurvival.com/mindset/do-you-notice-the-survival-warnings
Survival, Defense, Preparation. So, last week in Texas there was an attempted raid on a convention where the two gunmen were killed before they were able to get inside and kill anyone. This was supposedly sanctioned by ISIS. If that’s true or not, I don’t know. Here’s what bothers me about this situation and I’m sure I’ll hear something on both sides of this fence. Are we poking the bear by hosting contests to draw a sacred figure of the enemy? How many times have you heard someone mention that something...
TOTAL LINKS TO THIS WEBSITE
216
Coming Soon!
funmoneygames.com
The Sponsored Listings displayed above are served automatically by a third party. Neither the service provider nor the domain owner maintain any relationship with the advertisers. In case of trademark issues please contact the domain owner directly (contact information can be found in whois).
Fun Money Good – Fun Money Good Magazine
Fun Money Good Magazine. Scroll down to content. October 8, 2017. Welcome to WordPress. This is your first post. Edit or delete it, then start writing! Proudly powered by WordPress.
FMG Network
Love Your Whole Life. FMG TV/RADIO, MAGAZINE and CONTINUING EDUCATION. Providing you with the tools, resources, and confidence, to guide you to a happy, healthy, mindful life, loving it all. Our mission at FMG is to make a difference by sharing the voices, ideas and stories that make this world a better place. Presentation and Speaker Training. TV/Radio Show Host Training. Web and Graphic Design. Contact Us For Quote. Change is the end result of all true learning.". Featuring interviews, green living, sp...
HostGator Web Hosting Website Startup Guide
Purchase / Transfer Domain Name. HostGator.com Web Hosting.
Fun Money Mom - Fun, Family and Frugal Finds For The Modern Mom
Fun, Family and Frugal Finds For The Modern Mom. Tips & How To’s. Link Parties I Love. Share The Wealth Sunday Blog Hop #17. What a crazy week it’s been! My MIL fell and broke her hip and then a few days after that, my 3 year old daughter fell and had to get three staples in her head. Needless to say, they are getting to know us pretty well at the hospital. They are nice enough but not…. Read More ». 10 Things You Do Differently When You Have A Second Child. Read More ». While we’ve gone…. It was a fun w...
Fun Money Online - Ways to Save, Earn and Have Fun with Your Money!
Ways to Save, Earn and Have Fun with Your Money! Fun Money Tips at a Glance. Courses & Tutorials. Write Articles for Money. Low Prices, Bargains, % Discounts. Make Money with Smartphone. Learn How to Make Apps Online Courses. November 10, 2015. November 10, 2015. Learn how to make apps online with amazing instructional videos, quizzes, badges and training tracks. Apple or Android apps and…. 11/7/2015 – Today’s Walmart Online Specials Huge Holiday Savings. November 7, 2015. November 7, 2015. Receipt Hog R...
Fun Money World!
The domain name funmonger.com is for sale
You have reached a domain that is pending ICANN verification. As of January 1, 2014 the Internet Corporation for Assigned Names and Numbers (ICANN) will mandate that all ICANN accredited registrars begin verifying the Registrant WHOIS contact information for all new domain registrations and Registrant contact modifications. Why this domain has been suspended. Email address has not been verified. This is a new domain registration and the Registrant email address has not been verified. Wenn Sie Inhaber der...
funmonger.net - Unlimited Games, Movies, Music, Books & More
24 hours a day. Endless collections of Movies, Games, Books and Music for $39.95. Funmonger has the most comprehensive media catalogues on the Internet. Our content team works around the clock to bring you media you won't find anywhere else. We've got brand new and classic Movies, indie and AAA Games, hot new Apps, a huge library of Books, and endless choice in Music. You're only a few clicks away from a lifetime worth of amazing content, what are you waiting for? Optimized for all devices.
SOCIAL ENGAGEMENT