getawaygoaway.com getawaygoaway.com

GETAWAYGOAWAY.COM

getawaygoaway.com - Registered at Namecheap.com

This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.

http://www.getawaygoaway.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR GETAWAYGOAWAY.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

September

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Monday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 3.9 out of 5 with 16 reviews
5 star
8
4 star
2
3 star
4
2 star
0
1 star
2

Hey there! Start your review of getawaygoaway.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

CONTACTS AT GETAWAYGOAWAY.COM

E-CREATION ONLINE

JULIE FRANKE

10 PA●●●●●COURT

WIN●●●ROO , QLD, 4207

AUSTRALIA

6173●●●●0561
1555●●●●5555
JU●●●●●●●●●●@GMAIL.COM

View this contact

E-CREATION ONLINE

JULIE FRANKE

10 PA●●●●●COURT

WIN●●●ROO , QLD, 4207

AUSTRALIA

6173●●●●0561
1555●●●●5555
JU●●●●●●●●●●@GMAIL.COM

View this contact

E-CREATION ONLINE

JULIE FRANKE

10 PA●●●●●COURT

WIN●●●ROO , QLD, 4207

AUSTRALIA

6173●●●●0561
1555●●●●5555
JU●●●●●●●●●●@GMAIL.COM

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
2009 July 17
UPDATED
2014 July 14
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 16

    YEARS

  • 3

    MONTHS

  • 10

    DAYS

NAME SERVERS

1
dns1.registrar-servers.com
2
dns2.registrar-servers.com
3
dns3.registrar-servers.com

REGISTRAR

ENOM, INC.

ENOM, INC.

WHOIS : whois.enom.com

REFERRED : http://www.enom.com

CONTENT

SCORE

6.2

PAGE TITLE
getawaygoaway.com - Registered at Namecheap.com | getawaygoaway.com Reviews
<META>
DESCRIPTION
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
<META>
KEYWORDS
1 getawaygoaway com
2 coupons
3 reviews
4 scam
5 fraud
6 hoax
7 genuine
8 deals
9 traffic
10 information
CONTENT
Page content here
KEYWORDS ON
PAGE
getawaygoaway com
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

getawaygoaway.com - Registered at Namecheap.com | getawaygoaway.com Reviews

https://getawaygoaway.com

This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.

OTHER SITES

getawaygiveawaysweepstakes.com getawaygiveawaysweepstakes.com

getawaygiveawaysweepstakes.com

Click here to proceed.

getawaygiveawaysweepstakes.net getawaygiveawaysweepstakes.net

getawaygiveawaysweepstakes.net

Click here to proceed.

getawayglass.com getawayglass.com

Hover

This user has not enabled any redirections. Hover lets you easily create simple ways to access your digital life.

getawayglobaltours.com getawayglobaltours.com

GetawayGlobaltours

Your Destination to a Great Vacation! One Beautiful Trip at a Time. New Contact Us widget 1. Powered by InstantPage® from GoDaddy.com. Want one?

getawayglobaltrade.com getawayglobaltrade.com

Getaway Global Trade is family owned and operated Import and Export Company, located and licensed by the City of Orlando Florida, U.S.A. We currently export American grown high quality produce and dai

Getaway Global Trade Import and Export. Getaway Global Trade is an Import and Export Company driven by customer satisfaction! Whether you would like to Import American goods or Export your merchandise anywhere in the world, we are here to assist you every step of the way. We conduct our business with trust, integrity and respect. Our Company operates as a bridge between United State and other countries. We are multicultural company fluent in English, Arabic, French and Portuguese. Extra Virgin Olive Oil.

getawaygoaway.com getawaygoaway.com

getawaygoaway.com - Registered at Namecheap.com

This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.

getawaygolf.com.au getawaygolf.com.au

Getaway Golf and Leisure Travel Specialist

Call: 1300 187 255. Call: 1300 187 255. Buy a Gift Card. Buy a Gift Card. Buy a Gift Card. Golfing Holiday packages designed by GOLFERS for GOLFERS! With over 15 years in the business and thousands of happy clients GETAWAY GOLF AUSTRALIA is your GOLF TRAVEL SPECIALIST. As a professional travel agent, we are your one stop solution for flights, accommodation, car hire, travel insurance and more. We also specialise in group travel including conferences and special events. Click for more info. Coral Beach No...

getawaygolfbreaks.co.uk getawaygolfbreaks.co.uk

Account Suspended

This Account Has Been Suspended.

getawaygoods.com getawaygoods.com

Getawaygoods

Your browser does not support inline frames or is currently configured not to display inline frames.

getawaygopher.com getawaygopher.com

New Page 1

getawaygourmet.com getawaygourmet.com

Price Request - BuyDomains

Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.