
HOTELVIVEK.COM
Hotel Vivek – Business class hotel in NilgirisHotel Vivek is located adjacent to Ooty, generously sprawled across a side of the mountain our property over an acre and half.
http://www.hotelvivek.com/
Hotel Vivek is located adjacent to Ooty, generously sprawled across a side of the mountain our property over an acre and half.
http://www.hotelvivek.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
4 seconds
16x16
32x32
Privacy Protection Service INC d/b/a PrivacyProtect.org
Domain Admin
C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.or●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●rivacyProtect.org to contact the domain owner/operator
Nobb●●●●each , Queensland, QLD 4218
AU
View this contact
Privacy Protection Service INC d/b/a PrivacyProtect.org
Domain Admin
C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.or●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●rivacyProtect.org to contact the domain owner/operator
Nobb●●●●each , Queensland, QLD 4218
AU
View this contact
Privacy Protection Service INC d/b/a PrivacyProtect.org
Domain Admin
C/O ID#10760, PO Box 16 Note - Visit PrivacyProtect.or●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●●rivacyProtect.org to contact the domain owner/operator
Nobb●●●●each , Queensland, QLD 4218
AU
View this contact
19
YEARS
3
MONTHS
29
DAYS
PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM
WHOIS : whois.PublicDomainRegistry.com
REFERRED : http://www.PublicDomainRegistry.com
PAGES IN
THIS WEBSITE
13
SSL
EXTERNAL LINKS
5
SITE IP
66.96.147.106
LOAD TIME
4.024 sec
SCORE
6.2
Hotel Vivek – Business class hotel in Nilgiris | hotelvivek.com Reviews
https://hotelvivek.com
Hotel Vivek is located adjacent to Ooty, generously sprawled across a side of the mountain our property over an acre and half.
Banquets – Hotel Vivek
http://www.hotelvivek.com/banquets
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Green field - Banquet Hall. Expected strength of the function (required). Call Now: 0423-2230658 / 2231292. Everyone loves a great party and there is no better place to get the fun following than the Hotel Viveks with its varied banqueting options. Hotel Vivek offers for your benefits, a comprehensive party hall and a lush green lawn to throw your lavish parties while your kids are engaged at the designated play area. Jeera rice ,...
Standard Double – Hotel Vivek
http://www.hotelvivek.com/room/standard-room-one-king-bed
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. 1,10000 / Night. Hot water is available only between 6.30 am to 9.30 am. Pets are not allowed in the premises. Extra person charges for All Standard rooms is 200INR taxes. Extra person charges for All Deluxe rooms is 500INR taxes. 42 figure of '8' road,. Bedford Coonoor - 643 101,. Nilgiri district Tamil Nadu. MILESTONE BADGE FROM TRIP ADVISOR. Designed by Hashtag Technologies.
Deluxe Double – Without View – Hotel Vivek
http://www.hotelvivek.com/room/superior-room-two-double-beds
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Deluxe Double – Without View. Deluxe Double – Without View. 1,70000 / Night. 2 in a Room. Pets are not allowed in the premises. Extra person charges for All Standard rooms is 200INR taxes. Extra person charges for All Deluxe rooms is 500INR taxes. 42 figure of '8' road,. Bedford Coonoor - 643 101,. Nilgiri district Tamil Nadu. MILESTONE BADGE FROM TRIP ADVISOR. Designed by Hashtag Technologies.
About Us – Hotel Vivek
http://www.hotelvivek.com/about-us
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Any tourism is intended to provide an escape from the monotony of daily life and commercial life. That is the point which relaxes and rejuvenates our mind, which is the soul of travel and tourism. In the beautiful, small and clean city of COONOOR, we provide u with a handsome and hand-some package of this ethnic and non-commercial tourism. We welcome you to enjoy the beauty of nature! The Queen of Hills. Rolling grasslands, dense ...
Cottage – Hotel Vivek
http://www.hotelvivek.com/room/grand-superior-room-two-king-beds
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. 2,30000 / Night. 3 in a Room. Coffee Kettle With Guest Amenities. Colonial Interiors with Wooden Flooring. LED TV With Satellite Connection. Private Dining Area And a Sit Out With a Swing. Pets are not allowed in the premises. Extra person charges for All Standard rooms is 200INR taxes. Extra person charges for All Deluxe rooms is 500INR taxes. 42 figure of '8' road,. Bedford Coonoor - 643 101,. Nilgiri district Tamil Nadu.
TOTAL PAGES IN THIS WEBSITE
13
HashTag Technologies | Our Work
http://www.hashtagtechnologies.com/our-work
About Us About Us. Website Maintenance & Updates. Web Apps & Custom Software. Our Work Our Work. Contact Us Contact Us. Website Maintenance & Updates. Web Apps & Custom Software. See what HashTag can do for you! Aamro Freight & Shipping Services L.L.C. Aamro Freight & Shipping Services LLC. Diwali – 2016. Diwali – 2016. Fresh Farm Exports Honey Brochure. Fresh Farm Exports Wheat Brochure. Honey House – Label Design. IPL – 2016. Magic Cake – Insuvaii. Orange Bar Cake – Insuvaii. Pineapple – Insuvaii.
REALESTATE NILGIRIS - realestatenilgiris.com, Nilgiris, Kotagiri, Coonoor, Ooty, Gudalur, buy, sell, sale, realestate, land, properties, cottages, tea, coffee, farmhouse, apartments, flats, site, real, estate, house, real estate, bungalow, farm house, pro
http://www.realestatenilgiris.com/realestatecoonoor.php
Are you looking to buy or sell properties in. Leading and renowned real estate agency website in. We have thousands of properties for sale in. Interested in buying or renting a farm or land in. Tea and Coffee Estates. Has your property value increased? Call 91 9962202869 to find out your property value. Is a town, a municipality. In The Nilgiris District. State of Tamil Nadu. Best Season, Climate, and Clothing:. Max 25C, Min. 10C. Max 21C, Min. 5C. April to June and September to November. This is one of ...
Web Design Company India, Web Development Services, Cheapest SEO Services in India, Web Solutions Coimbatore, Web Hosting, Email Hosting Coimbatore, Tamilnadu, India
http://www.yagnatechnologies.com/portfolio.php
91 92 4444 4229. Http:/ www.harshithaatravels.com. Http:/ www.idirecthost.com. Http:/ www.jayceeschool.com. Http:/ www.barcodelabels.co.in/. Http:/ www.pskherbals.com. India : 91 979 12 12 875. Canada : 1 (647) 505 7773. UK, United Kingdom, London, Ireland, Scottland, US, Canada, Australia, South Africa, Gulf. Karnataka, Bangalore, Mysore, Kerala, West bengal, Delhi, MP, Goa, Tamilnadu. Coimbatore, Chennai, Erode, Salem, Trichy, Kochi.
Web Design Company India, Web Development Services, Cheapest SEO Services in India, Web Solutions Coimbatore, Web Hosting, Email Hosting Coimbatore, Tamilnadu, India
http://www.yagnatechnologies.com/index.php
Web Design Company India, Web Development Services, Cheapest SEO Services in India, Web Solutions Coimbatore, Web Hosting, Email Hosting Coimbatore, Tamilnadu, India. 91 92 4444 4229. WELCOME TO YAGNA TECHNOLOGIES. DELIVERING HIGH VALUE and COMPREHENSIVE RELIABLE WEB SOLUTIONS! CAPTIVATING AND APPEALING DESIGNING. Make Your Website User Friendly. For Better User Interaction And Satisfication. Cost Effective Way to Reach. Our amazing Products and services and others listed below. Web Development: We devel...
TOTAL LINKS TO THIS WEBSITE
5
Hotel Vivar en Griñón. Web Oficial.
Esta página web utiliza cookies. Al continuar navegando por ella, usted acepta el uso de cookies. Habitación familiar (2 adultos 2 niños). Menores de 12 años. Fecha de la reserva. LAS MEJORES OFERTAS Y PROMOCIONES. Aprovecha los mejores descuentos en tu estancia en Hotel Vivar. Reservando en la web oficial todo son ventajas. Hotel Vivar, un cálido hotel familiar en Griñón. A qué esperas para venir a visitarnos? Si te alojas un mínimo de 2 noches en el hotel, disfrutarás estos descuentos:. Esta promoción ...
hotelvivas.com
The domain hotelvivas.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
hotelvivawyndhamaztecarivieramaya.com
Hotel Viva Wyndham Azteca
Hotel Viva Wyndham Azteca. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Azteca Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Azteca y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. Reserva el Hot...
Wyndham Hotel Loyalty Program Free travel rewards program Riviera Maya
WYNDHAM Hotels Mexico Cancun -Playa del Carmen - Queretaro - Leon Guanajauto. Wyndham Loyalty Program with Wyndham Hotels Mexico. Can't wait for Wyndham rewards? Now you don't have to. Our Wyndham deals and discounts help you rack up points quicker so you can get rewards faster and save a bundle along the way. With so many Wyndham hotels and partners to choose from, scoring deals has never been easier. Wyndham Azteca Playa del Carmen. Wyndham Maya Playa del Carmen. Wyndham Garden Barranquilla, Colombia.
hotelvivawyndhammayaplayadelcarmen.com
Hotel Viva Wyndham Maya
Hotel Viva Wyndham Maya. Tu Eliges Como Pagar Las tarifas más económicas garantizadas con las mejores opciones de pago compruébalo ya. Hotel Viva Wymdham Maya Llama Gratis al 01-800-060-2532. Reserva del 20 de Marzo al 2 de Abril 2018 y viaja todo el año a Riviera Maya con descuentos en el Hotel Viva Wymdham Maya y hasta 50% en Boletos de Avión. Obtén las mejores promociones en Hoteles, Viajes y Paquetes disponibles en Viajes de Semana Santa 2018. En Riviera Maya. Consigue 2 menores. De 12 años GRATIS.
Hotel Vivek – Business class hotel in Nilgiris
Book Now via Phone: 0423-2230658 / 2231292 or Email: hotelvivek@gmail.com. Guests sink into deep chairs and gaze at nature’s canopy of clear sky while we serve the most delicious range of dishes cooked with farm fresh vegetables and poultry at ‘Green Field’ our garden restaurant. Rainbow is the bar that lies above expectations with everything it offers. Our extensive range of premier brands and other divergent choice of spirits makes this place a great social hub. Travel Desk and Tourism. First of all , ...
Welcome to Hotel Vivek, Ratnagiri.
Developed by: SoftLogic, Ratnagiri. The hotel was established by Mr. Kamlakar Desai and Mr. Ramakant Desai on 18th October 1982 at a central location of the city of Ratnagiri with a motto to serve our customers. We are committed to meeting and exceeding the expectations of our guests through our unremitting dedication to every aspect of service and to gratify our customers.
Hotel Viveka | Hotels in Kurunegala | Wedding Halls in Kurunegala | Rooms in Kurunegala
T : 94 37 2222 897 Booking Request. INQUIRE FOR A RESERVATION. Welcome To Hotel Viveka. Nearly 125 year old Viveka has been restored back to its old glory by the present owners and since the late nineties she has been the home away from home with all the modern comforts to the weary traveller. ( See Facilities ) Being small you get individual attention from the staff. North Lake Road,. Kurunegala, Sri Lanka. T : 94 37 2222 897. M : 94 77 5354 866. E : info@hotelviveka.com / info@hotelviveka.com.
hotelvivek
Hotel Vivek Jammu
Hotel Vivek, Jammu is a 2 star hotel which is located amongst delightful scenery and has various facilities such as restaurant, air conditioning, availability of doctor, etc. to satisfy customers requirements. Moreover, it is located at a distance of nearly 4 kms from the railway station and 7 kms from Jammu Airport. The hotel offers 24 rooms for its guests and accommodation is provided in three categories: AC Deluxe Superior, AC Deluxe Executive, and Family Suit. Come have a Look into Our Hotel.
Hotel Vivek Plaza – Hotel in Ambala
Book Super deluxe or deluxe room and get welcome drink and complementary breakfast. Super Deluxe @ 2,199/-. Deluxe room @ 1599/-. Book Super deluxe or deluxe room and get 25% discount including complementary breakfast. Hotel Vivek Plaza, 12 Cross Road, Opposite Ambedkar Park, near Sewa Samiti School, Ambala Cantt. 133 001. Phone: 91 171 4000984, 4007117. Theme by SKT Themes.
SOCIAL ENGAGEMENT