We help you discover influencer marketing news, events, tips and advice worth caring about. That’s because we care about quality influencer marketing and the growing business and audience for it.
http://influencermarketing.co.uk/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.9 seconds
16x16
32x32
64x64
128x128
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
18
SITE IP
104.196.144.144
LOAD TIME
1.937 sec
SCORE
6.2
Influencer Marketing | News, Advice and Tips on Influencer Marketing | influencermarketing.co.uk Reviews
https://influencermarketing.co.uk
We help you discover influencer marketing news, events, tips and advice worth caring about. That’s because we care about quality influencer marketing and the growing business and audience for it.
influencermarketing.co.uk
How To Stay Authentic With Influencer Marketing
http://www.influencermarketing.co.uk/stay-authentic-influencer-marketing
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Dec 23, 2016. We all have...
Fresh Faces: Mikey DeTemple - Influencer Marketing
http://www.influencermarketing.co.uk/fresh-faces-mikey-detemple
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Dec 12, 2016. A monthly s...
How To Harness Snapchat For Business
http://www.influencermarketing.co.uk/harness-snapchat-for-business
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Dec 15, 2016. The metamor...
Fresh Faces Archives - Influencer Marketing
http://www.influencermarketing.co.uk/category/fresh-faces
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Fresh Faces: Emma Bates.
Micro-Influencers: The New Celebrities? - Influencer Marketing
http://www.influencermarketing.co.uk/micro-influencers-new-celebrities
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Oct 3, 2016. Apparently s...
TOTAL PAGES IN THIS WEBSITE
20
Influencer Marketing Case Study - Bonobos BetterthanAC
http://br.billiondollarboy.com/portfolio/influencer-marketing-case-study-bonobos-betterthanac
Bonobos – #BetterThanAC. 8220;A Bonobos inspira seus consumidores com a campanha de verão. Lançar a nova coleção de roupas da Bonobo de uma maneira que gere engajamento e WOM nas redes sociais e nos canais da marca. Curtidas, Comentários and Compartilhamentos. Mais Que a Média de Engajamento da Marca. London New York Istanbul São Paulo. Billion Dollar Boy Ltd. 2016 saopaulo@billiondollarboy.com I 55 (11) 3199-0258.
Marketing de Influenciadores | Lendas do Crime StudioCanal | Facebook
http://br.billiondollarboy.com/portfolio/brincando-de-tinder
8220;Tinder e a melhor forma para conhecer pessoas novas perto de voce ”. Criar conteu do jovem, divertido, cool e bonito sobre o Tinder que tenha a cara de conteu do orga nico e esponta neo. Selecionamos duas queridinhas do YouTube, as influencers formadoras de opinia o Giovanna Ferrarezi and Cacau Lemos – as quais redes sociais na o pa ram de crescer. 8220;Me casei com um rapaz que conheci no Tinder! 8211; Nicole Martins. London New York Istanbul São Paulo.
Geeks em Estratégia de Influencer Marketing - Billion Dollar Boy
http://br.billiondollarboy.com/influencer-marketing-strategists
Conheça os Aficcionados em Influencer Marketing . A Billion Dollar Boy é composta de um grupo de experts em marketing de influência e comunicação – planners e criativos que não se cansam de consumir conteúdo online. Nos diferenciamos pelos projetos que escolhemos fazer parte, e pelo conteúdo que produzimos para os nossos clientes. Todos os dias, o nosso time desenvolve maneiras inovadoras de interagir com a audiência dos influencers, e como melhor comunicar a mensagem da sua marca. Director, New York.
Marketing de Influenciadores - Lançamento Ford GT & Mustang Shelby
http://br.billiondollarboy.com/portfolio/influencer-marketing-case-study-ford-naias
Ford – Auto Show de Detroit 2015. Ford – Detroit Auto Show 2015. 8220;Cobertura Ao Vivo Atinge o Topo das Pesquisas Youtube and Google.”. A Ford queria lançar o seu novo Ford GT e Mustang Shelby e fazer barulho p/ os seus fãs, convidando influenciadores p/ o Auto Show Internacional da América do Norte. Nos Resultados de Pesquisas Google and Youtube. Curtidas, Comentários and Compartilhamentos. Mustangs vendidos em Fevereiro and Março. London New York Istanbul São Paulo.
Influencer Matching - Billion Dollar Boy Brasil
http://br.billiondollarboy.com/influencer-matching
Com nossa experiência de mercado, dados analíticos, planejamento e criatividade, identificamos o influencer perfeito pro seu brief, criando campanhas de conteúdos autênticos, originais, e para grandes audiências. Procuramos por mais de 40 mil influencers brasileiros nas redes sociais utilizando o nosso próprio sistema de buscas o MatchMaker BR. Nosso MatchMaker produz uma lista de potenciais influenciadores, que a nossa equipe cuidadosamente analisa, cruzando esta análise e informações com o seu brief.
Billion Dollar Boy - A Agência Global de Marketing de Influência
http://br.billiondollarboy.com/get-started
Main Social Media URL. British Indian Ocean Territory. Cocos ( Keeling ) Islands. Côte d ' Ivoire. Croatia ( Hrvatska ). Congo ( DRC ). Falkland Islands ( Islas Malvinas ). French Southern and Antarctic Lands. Heard Island and McDonald Islands. Macedonia, Former Yugoslav Republic of. São Tomé and Prìncipe. South Georgia and the South Sandwich Islands. St Kitts and Nevis. St Pierre and Miquelon. St Vincent and the Grenadines. Svalbard and Jan Mayen. Turks and Caicos Islands. Virgin Islands ( British ).
Marketing de Influência - Case de Sucesso - Danio Grito de Fome
http://br.billiondollarboy.com/portfolio/influencer-marketing-case-study-danio-hunger-cry
Danio – O Grito Da Fome. Danio – Morto De Fome. 8220;O Lanche da Tarde Perfeito”. Posicionar a Danio para o público masculino como o. Perfeito para saciar sua fome durante à tarde. 8220;Gritos da Fome” criados por fans. Aumento médio nas vendas. 8220;OMG… Faz meses que não dou tanta risada… Você comendo aquele iogurte… top! London New York Istanbul São Paulo. Billion Dollar Boy Ltd. 2016 saopaulo@billiondollarboy.com I 55 (11) 3199-0258.
Marketing de Influenciadores - Case de Sucesso - EE BAFTAs
http://br.billiondollarboy.com/portfolio/influencer-marketing-case-study-ee-baftas
EE – #BAFTAPlus1. 8220;O backstage VIP”. Como patrocinador oficial do BAFTAs, a EE queria utilizar sua nova câmera 4GEE Capture Cam para registrar momentos mais íntimos do show. Audiência masculina e Engajamento. Duração média dos views. London New York Istanbul São Paulo. Billion Dollar Boy Ltd. 2016 saopaulo@billiondollarboy.com I 55 (11) 3199-0258.
Gerenciamento de Campanhas de Influência - Billion Dollar Boy
http://br.billiondollarboy.com/influencer-campaign-management
Achar o influencer perfeito pra sua campanha é apenas o começo. Billion Dollar Boy tem histórico comprovado em desenvolver e entregar campanhas bem sucedidas de influencer marketing end-to-end – desde a criação, até distribuição, gerenciamento de campanha, e relatório de performance. Nossa equipe de estrategistas, digital e criação trabalham a quatro mãos, e de mãos dadas com a sua equipe e os influencers, para desenvolver a idéia criativa mais adequada para a sua campanha. Desenvolver uma idéia criativa.
TOTAL LINKS TO THIS WEBSITE
18
Coach Gregory
Registro de dominios, hosting, vps - Interdominios
Registro de dominios, hosting, vps - Interdominios. Esta es la página por defecto de tu dominio www.influencerlife.com. Para añadir productos asociados a tu dominio puedes visitar nuestra web www.interdominios.com. La solución completa, un revolucionario Hosting con Creador Web a un precio sin competencia, con dos meses GRATIS y regalo de dominio con Pago Anual.
My great WordPress blog | Just another WordPress site
My great Wordpress blog. May 31, 2014. Welcome to WordPress. This is your first post. Edit or delete it, then start blogging! Just another WordPress site. Proudly powered by WordPress.
influencermanagement.com is for sale!
Influencermanagement.com is for sale! A domain name like influencermanagement.com has all the characteristics of a great domain. See the listing. Domains that include search keywords position your brand and boost your search engine presence. A premium generic com domain like influencermanagement.com is well suited for many purposes. This domain is available and ready to be used now! Ownership of this domain has been verified through the Flippa marketplace.
Influencer Marketing | News, Advice and Tips on Influencer Marketing
Influencers Aren’t New, They’ve Just Changed. How To Stay Authentic With Influencer Marketing. Will Pinterest Be The Next Big Influencer Marketing Platform? Two More Powerful Than One: Instagram Couples to Watch. How To Harness Snapchat For Business. 5 Best Ways To Work With Influencers. Top Tips for using Instagram to market your brand. 5 Tips for Influencer Marketing Campaigns on Instagram. 4 Kinds of Content Men Actually Like On Social. Micro-Influencers: The New Celebrities? Billion Dollar Boy Team.
Influencer50
InfluencerTracker Lite & Premium. Interviews & Podcasts. Influencer Exec. Benchmarking. For Smaller to Mid-Sized Businesses. We can’t think of anyone with more global experience of Influencer Identification and Engagement than our company. We started Influencer50 in 2004, before anyone was talking about the importance of market influencers. In 2009 we wrote the book ‘Influencer Marketing: Who Really Influences Your Customers? We’ve worked for clients in almost forty countries across four continents, in m...
Influencer Marketing | Great way to learn internet affiliate marketing.
Great way to learn internet affiliate marketing. Why Is My Affiliate Marketing Efforts Failing. If you find yourself asking “Why are my affiliate marketing efforts not working? 8221; you aren’t alone. Anyone can make an affiliate marketing program work and become successful at it but there are several things that you need to make sure. March 20, 2016. How Build An Internet Marketing Business Using Only Article Marketing. March 19, 2016. Why Internet Marketing is Crucial to Your Business. March 18, 2016.
influencermarketingacademy-review.com
Influencer Marketing Academy Honest Review & Bonus (DON'T BUY) | Don't buy the Influencer Marketing Academy until you have read our honest review and alternative!
Influencer Marketing Academy Honest Review and Bonus (DON'T BUY). Don't buy the Influencer Marketing Academy until you have read our honest review and alternative! Influencer Marketing Academy Review. Influencer Marketing Academy Review & Bonus. Published December 19, 2016. Don DeSilva’s Influencer Marketing Academy Review and Bonus. 12 Jan. 17. Influencer Marketing Academy Review. What is Influencer Marketing? These social sites included:. Don was blown away by how quick and how much traffic he was able...
influencermarketingacademy.com
Influencer Marketing Academy
Welcome to WordPress. This is your first post. Edit or delete it, then start blogging!
influencermarketingacademyreview.net
Influencer Marketing Academy Review & Bonus – Best Influencer Marketing Training Available!
Skip to main content. Influencer Marketing Academy Review. Influencer Marketing Academy Launches January 12th! December 12, 2016. December 13, 2016. Influencer Marketing Academy Review. This review aims to give you a sneak peak into Influencer Marketing Academy developed by Dan DeSilva, which will be released in January 12 in 2017. Influencer Marketing Academy Breakdown. Main Offer Influencer Marketing Academy $1297. Influencer Marketing Academy is very easy to use and just about everyone can implement t...
SOCIAL ENGAGEMENT