
instinctualdesign.blogspot.com
Ashley Wakefield HNDHND Graphic Design Student Salford University
http://instinctualdesign.blogspot.com/
HND Graphic Design Student Salford University
http://instinctualdesign.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
0.7 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
1
SITE IP
172.217.3.97
LOAD TIME
0.723 sec
SCORE
6.2
Ashley Wakefield HND | instinctualdesign.blogspot.com Reviews
https://instinctualdesign.blogspot.com
HND Graphic Design Student Salford University
Ashley Wakefield HND: I'm back!
http://instinctualdesign.blogspot.com/2011/01/im-back.html
HND Graphic Design Student Salford University. Thursday, 13 January 2011. Well, this blog has now been marked and so I shall now resume updating. Expect to see what i'm up to in regards to briefs, side projects, what inspires me, might even do a tutorial or two. But for now this shall do. More updates soon! Subscribe to: Post Comments (Atom). There was an error in this gadget. Other places to find me. Http:/ mustash2003.deviantart.com/. Http:/ www.flickr.com/photos/ashleywakefield/. Todah :). Here is...
Ashley Wakefield HND: February 2011
http://instinctualdesign.blogspot.com/2011_02_01_archive.html
HND Graphic Design Student Salford University. Thursday, 24 February 2011. I recently went on a trip with Salford University to London to see the 4 Designers conference. And visited two design studios, Elmwood. I also saw the design museum, which was a lot of fun. It was very inspiring to see lot's of designers opinions and takes on the design industry, their approaches to their work and to see two agencies first hand was very welcome. I've attached a few photos from my trip. Friday, 11 February 2011.
Ashley Wakefield HND: Peter Cross
http://instinctualdesign.blogspot.com/2010/10/peter-cross.html
HND Graphic Design Student Salford University. Tuesday, 26 October 2010. Peter Cross is a UK illustrator who specialise in book illustrations. He was a technical illustrator before he became freelance. Http:/ www.anthonyphillips.co.uk/associates/pc.htm. Subscribe to: Post Comments (Atom). There was an error in this gadget. Other places to find me. Http:/ mustash2003.deviantart.com/. Http:/ www.flickr.com/photos/ashleywakefield/. Http:/ uk.linkedin.com/pub/ashley-wakefield/28/454/936. Ill probably revise ...
Ashley Wakefield HND: January 2011
http://instinctualdesign.blogspot.com/2011_01_01_archive.html
HND Graphic Design Student Salford University. Thursday, 13 January 2011. Well, this blog has now been marked and so I shall now resume updating. Expect to see what i'm up to in regards to briefs, side projects, what inspires me, might even do a tutorial or two. But for now this shall do. More updates soon! Subscribe to: Posts (Atom). There was an error in this gadget. Other places to find me. Http:/ mustash2003.deviantart.com/. Http:/ www.flickr.com/photos/ashleywakefield/. View my complete profile.
Ashley Wakefield HND: Feedback For DPS/Advert 2
http://instinctualdesign.blogspot.com/2010/11/feedback-for-dpsadvert-2.html
HND Graphic Design Student Salford University. Saturday, 27 November 2010. Feedback For DPS/Advert 2. SoI apparently have the internet despite being under the impression it was off this weekend. So, i'll do a post on the feedback I got on Thursday. Some mistakes, different font would work better DPS1. Some mistakes, different font would work better DPS 2. Hard to read type Advert. Looks fine no problem DPS 1. Great but pixelated circle Design Agency DPS. Fix logo on Advert. All references given on blog.
TOTAL PAGES IN THIS WEBSITE
19
instinctual behavior expert
World Future Institute Established By Manyone And Academy Of Science And Arts. Manyone Web And App Internet Consulting And Cloud Integration Offices Set To Open Worldwide In 2015. Manyone Internet Laboratories Set To Reinvent Cause-related Global And Local Movements By Connecting Stadiums, Studios And Systems. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. First Contact Revealed In Blockbuster Book. Letter...
instinctual behavior portal
World Future Institute Established By Manyone And Academy Of Science And Arts. Manyone Web And App Internet Consulting And Cloud Integration Offices Set To Open Worldwide In 2015. Manyone Internet Laboratories Set To Reinvent Cause-related Global And Local Movements By Connecting Stadiums, Studios And Systems. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. First Contact Revealed In Blockbuster Book. Letter...
Instinctual Birth
CLICK HERE FOR THOUSANDS OF FREE BLOGGER TEMPLATES. Thursday, May 27, 2010. Top 100 Natural Birthing Blogs. I am incredibly honored to be listed at number 24 on the Top 100 Natural Birthing Blogs! I guess I should write here too. I've been spending time developing my breastfeeding blogs, atmybreast.com. My personal one) and breastfeedingrevolution.com. My change the world one). Please hop on over there and check them out, too. :). Links to this post. Sunday, March 21, 2010. Maybe we should form a wet nur...
instinctualbirthing.wordpress.com
Protected Blog › Log in
Https:/ instinctualbirthing.wordpress.com/. Is marked private by its owner. If you were invited to view this site, please log in. Below Read more about privacy settings. Larr; Back to WordPress.com.
www.instinctualcooking.com
This Web page parked FREE courtesy of Domains Priced Right. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. Find Your Own Domain Name. See our full line of products. Easily Build Your Professional Website. As low as $4.99/mo. Call us any time day or night (480) 624-2500.
instinctualdesign.blogspot.com
Ashley Wakefield HND
HND Graphic Design Student Salford University. Sunday, 6 March 2011. Http:/ ashleywakefieldopenuniversitybrief.blogspot.com/. Open University Brief - YCN. Http:/ ashleywakefieldpenguin.blogspot.com/. Http:/ ashleywakefieldwhtyeandmackay.blogspot.com/. Whtye and Mackay - YCN. Http:/ ashleywakefieldlivebrief.blogspot.com/. Thursday, 24 February 2011. I recently went on a trip with Salford University to London to see the 4 Designers conference. And visited two design studios, Elmwood. Sunday, 6 February 2011.
InstinctualDesire.com is available at DomainMarket.com
Ask About Special March Deals! What Are the Advantages of a Super Premium .Com Domain? 1 in Premium Domains. 300,000 of the World's Best .Com Domains. Available For Immediate Purchase. Safe and Secure Transactions. 24/7 Customer Support: 888-694-6735. Search For a Premium Domain. Or Click Here To Get Your Own Domains Appraised. Find more domains similar to InstinctualDesire.com. We are constantly expanding our inventory to give you the best domains available for purchase! Domains Added in the Past Month.
instinctual emotion
Rocketing to the moon in minutes not days, Landing on mars in hours not months. Quotes From Our Institute Directors, Enterprise Directors and Executives. Academy of Science and Arts to establish World Headquarters for Enterprises and Institutes across Utah’s Wasatch Front. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. Manyone Pioneers Uncharted Territory In Becoming the First Open Source Corporation.
instinctual emotion
Rocketing to the moon in minutes not days, Landing on mars in hours not months. Quotes From Our Institute Directors, Enterprise Directors and Executives. Academy of Science and Arts to establish World Headquarters for Enterprises and Institutes across Utah’s Wasatch Front. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. Manyone Pioneers Uncharted Territory In Becoming the First Open Source Corporation.
instinctual emotion expert
Rocketing to the moon in minutes not days, Landing on mars in hours not months. Quotes From Our Institute Directors, Enterprise Directors and Executives. Academy of Science and Arts to establish World Headquarters for Enterprises and Institutes across Utah’s Wasatch Front. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. Manyone Pioneers Uncharted Territory In Becoming the First Open Source Corporation.
instinctual emotion expert
Rocketing to the moon in minutes not days, Landing on mars in hours not months. Quotes From Our Institute Directors, Enterprise Directors and Executives. Academy of Science and Arts to establish World Headquarters for Enterprises and Institutes across Utah’s Wasatch Front. ManyOne Unveils the Internet Office Network, the Evolution of USWeb/CKS as the Leader in Integrating Domains, Sites and Apps for Internet Devices. Manyone Pioneers Uncharted Territory In Becoming the First Open Source Corporation.
SOCIAL ENGAGEMENT