
JAKESWEENEYFIATBLOG.COM
Jake Sweeney FIAT Blog |Ready to drive home in a new vehicle? Then let Jake Sweeney FIAT appraise your current ride for a trade in!
http://www.jakesweeneyfiatblog.com/
Ready to drive home in a new vehicle? Then let Jake Sweeney FIAT appraise your current ride for a trade in!
http://www.jakesweeneyfiatblog.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Sunday
LOAD TIME
0.4 seconds
16x16
32x32
64x64
128x128
L2TMedia
Bryan Zawlocki
1840 ●●●●●venue
Evan●●●●n IL , Illinois, 60201
UNITED STATES
View this contact
Liz Prior
990 ●●●●r Dr
Gle●●●iew , Illinois, 60025
UNITED STATES
View this contact
Liz Prior
990 ●●●●r Dr
Gle●●●iew , Illinois, 60025
UNITED STATES
View this contact
11
YEARS
7
MONTHS
12
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
11
SSL
EXTERNAL LINKS
21
SITE IP
50.116.73.113
LOAD TIME
0.385 sec
SCORE
6.2
Jake Sweeney FIAT Blog | | jakesweeneyfiatblog.com Reviews
https://jakesweeneyfiatblog.com
Ready to drive home in a new vehicle? Then let Jake Sweeney FIAT appraise your current ride for a trade in!
The FIAT 500X, Coming To A Screen Near You | Jake Sweeney FIAT Blog
http://jakesweeneyfiatblog.com/the-fiat-500x-coming-to-a-screen-near-you
Jake Sweeney FIAT Blog. July 7, 2015. The FIAT 500X, Coming To A Screen Near You. Which is the larger than life crossover vehicle. NBCUniversal’s in-house Content Innovation Agency (CIA) – not to be confused with the actual CIA – is creating a robust collection of branded content to be put out over many networks and social platforms. FIAT U.S. head of marketing communication’s Casey Hurbis said Working with director Dennie Gordon and the NBCUniversal team to create custom content that aligns with...And i...
Land of the Free, Home of the new FIAT | Jake Sweeney FIAT Blog
http://jakesweeneyfiatblog.com/land-of-the-free-home-of-the-new-fiat
Jake Sweeney FIAT Blog. June 16, 2015. Land of the Free, Home of the new FIAT. FIAT automakers recently held a press conference in which they unveiled that while most of us will be crushing brews, eating hot dogs and brats, Italy will invading the great USA. But you have nothing to worry about, in fact, this is more cause for celebration! The brightly colored, retro-styled Italian invasion is headed by a brand new FIAT car. And resembling a somewhat downsized version of the 2015 FIAT 500X. Get a Personal...
New 2016 FIAT 500 Spotted in Wild | Jake Sweeney FIAT Blog
http://jakesweeneyfiatblog.com/new-2016-fiat-500-spotted-in-wild
Jake Sweeney FIAT Blog. June 25, 2015. New 2016 FIAT 500 Spotted in Wild. The other week we talked about the July 4th unveiling of the brand new 2016 model year FIAT 500 and what it will entail. We were told we can expect a bit of a physical redesign with new oval headlights and a new styling in the rear, while the base engine option, a 1.4-liter V4 with 101 horsepower remains similar but upgraded to fit modern needs. On your current FIAT model, head on down to our dealership for any of your needs. Land ...
Going Faster in the 2015 FIAT Abarth | Jake Sweeney FIAT Blog
http://jakesweeneyfiatblog.com/going-faster-in-the-2015-fiat-abarth
Jake Sweeney FIAT Blog. August 10, 2015. Going Faster in the 2015 FIAT Abarth. Small and wicked. That’s what describes the. 2015 FIAT 500 Abarth. And if the scorpion insignia is any indication of what you’ll experience in this little hellraiser of a compact car then you can expect quite the wild ride. The FIAT 500 packs a lot into a little and while most versions of the car embody a fun and quirky Italian motif with rounded edges and fun accents, the Abarth and. To feel power of a racecar in the fun-size...
FIAT is Connecting You to the World Around You, Helping You Park | Jake Sweeney FIAT Blog
http://jakesweeneyfiatblog.com/fiat-is-connecting-you-to-the-world-around-you-helping-you-park
Jake Sweeney FIAT Blog. June 11, 2015. FIAT is Connecting You to the World Around You, Helping You Park. The FIAT company has a long history of not only making fun automobiles, but making them safe as well. Modern FIAT models like the 2015 FIAT 500, 500C, 500L, 500X, and FIAT 500 Abarth are swathed in clever Italian design that offer plenty of customization, technologically advanced infotainment systems, and incredible safety features. Tags: FIAT service and parts. New 2015 FIAT vehicle.
TOTAL PAGES IN THIS WEBSITE
11
Jake Sweeney FIAT | New FIAT dealership in Florence, KY 41042
http://www.fiatusaofflorence.com/fiat500-compare-2014.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Compare the 2014 FIAT. 500 to the Competition. By submitting your contact information, you consent to be contacted by telephone about purchasing a vehicle or obtaining vehicle financing. Clicking on the Submit button above is your electronic signature. 500 to the Competition. MAXIMUM POWER BHP at RPM. 101 at 6,500. 134 at 4,500-6,000. 70 at 5,800.
Directions & Hours | Jake Sweeney FIAT | Near Cincinnati, OH
http://www.fiatusaofflorence.com/dealership/directions.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Directions to Jake Sweeney Alfa Romeo-FIAT. Finding a new 2016 FIAT car. In Florence, KY has never been easier. Using our interactive map below to get directions to Jake Sweeney FIAT. Head on in to test drive a new FIAT 500L. Or see how amazing the 2016 FIAT 500X. Website by Dealer.com. Legal Notifications and Disclaimers. New to our site? Acces...
Featured New Vehicles | Alfa Romeo & FIAT Dealer | Florence, KY
http://www.fiatusaofflorence.com/featured-vehicles/new.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Jake Sweeney FIAT provides a selection of Featured New Inventory, representing new and popular items at competitive prices. Please take a moment to investigate these current highlighted models, hand-picked from our ever-changing inventories! 2015 FIAT 500 Pop. Laser Blu (Bright Met. Blue). 2016 FIAT 500X Trekking. 2016 FIAT 500X Trekking. Images...
Jake Sweeney Alfa Romeo-FIAT | New & Used Car Dealer | Florence, KY
http://www.fiatusaofflorence.com/index.htm
New and Used Inventory. Financing and Trade-In Appraisal. FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Leave Us a Review! AS ICONIC AS ITS DESIGN. 2015 FIAT 500 Pop. Laser Blu (Bright Met. Blue). 2016 FIAT 500X Easy. Bianco Gelato (White Clear Coat). 2015 FIAT 500 Pop. Fill out our quick financing pre-approval form to get into your new vehicle even faster. Research all of our models and trims in our on line studio. Need to know where we are located? Featuring not only F...
Featured Used Vehicles | Near Lexington, KY | Jake Sweeney Alfa Romeo FIAT
http://www.fiatusaofflorence.com/featured-vehicles/used.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Featured Used Vehicles In Florence, KY. At Jake Sweeney Alfa Romeo-FIAT. We are pleased to offer not only the latest from FIAT like the 2016 FIAT 500X. And the 2015 FIAT 500 Abarth. But also an impressive selection of used and pre-owned vehicles near Lexington, KY. We have both used FIAT. Or stop by 5959 Centennial Circle for a test drive today!
New Vehicle Studio | Jake Sweeney FIAT | Near Cincinnati, OH
http://www.fiatusaofflorence.com/showroom/index.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. At Jake Sweeney FIAT. In Florence, KY, you can be sure to find a brand new 2016 FIAT car. That suits your style and budget. We have an exciting lineup of new FIAT vehicles, like the 2016 FIAT 500 and the 2016 Fiat 500 Abarth! With options like these, who can go wrong? Jake Sweeney FIAT is an experienced FIAT dealership in Florence, KY. When pric...
in Florence, KY | Jake Sweeney FIAT
http://www.fiatusaofflorence.com/certified-inventory/cpov.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Fill out this quick and secure form and we'll get back to you right away! By submitting your contact information, you consent to be contacted by telephone about purchasing a vehicle or obtaining vehicle financing. Clicking on the Submit button above is your electronic signature. 150 deductible per repair visit for covered components. A large ord...
Value Your Trade In | Jake Sweeney Alfa Romeo-FIAT | Florence, KY
http://www.fiatusaofflorence.com/kbb.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. Kelley Blue Book at Jake Sweeney Alfa Romeo-FIAT. Value Your Trade In at Jake Sweeney Alfa Romeo-FIAT in Florence, KY. Identify the estimated trade in value for your current vehicle by using the Kelley Blue Book tool provided below. Jake Sweeney Alfa Romeo-FIAT. Website by Dealer.com. Legal Notifications and Disclaimers. New to our site? Would y...
2015 FIAT 500c Pop | Jake Sweeney Alfa Romeo-FIAT | Near Middleton, OH
http://www.fiatusaofflorence.com/2015-fiat-500c-pop-at-jake-sweeney-alfa-romeo-fiat.htm
New and Used Inventory. Financing and Trade-In Appraisal. KBB Instant Cash Offer! FIAT 500 vs. Competition. Express Lane Oil Change Service. Our Studio About Us. 2015 FIAT 500c Pop at Jake Sweeney Alfa Romeo-FIAT. 500c Pop is a car made for people who love to experience everything about driving. The 2015 FIAT 500c Pop. From Jake Sweeney Alfa Romeo-FIAT. Is a fun and expressive small car that '. S available right here at our FIAT dealership in Florence where we '. 2015 FIAT 500c Pop Details. S why they bu...
TOTAL LINKS TO THIS WEBSITE
21
Jake Sweeney Body Shop
169 Northland Boulevard Cincinnati, OH 45246. Jake Sweeney Body Shop. Has moved to a brand new 30,000 square foot facility located just a block from Jake Sweeney Auto Mall in Tri-County. Our new location, 169 Northland Blvd. Features all new, state-of-the-art equipment and a highly experienced staff that will provide you with excellent customer service and quality workmanship. We will work with your insurance company, not for your insurance company, never sacrificing quality to save money at your expense.
New and Used Cincinnati Chevrolet Dealer | Jake Sweeney Chevrolet
33 West Kemper Road. Get Pre-Approved in Seconds. Budget Buys Under $9995. Get Pre-Approved in Seconds. Used Car Super Store. Buy Here Pay Here. After Hours Drop Off. Get Pre-Approved in Seconds. About Jake Sweeney Automotive. Jake Sweeney Buy Here Pay Here (209). Jake Sweeney Chevrolet (937). Truck Crew Cab (75). Truck Double Cab (53). Truck Extended Cab (15). Truck Quad Cab (2). Truck Regular Cab (17). Truck Super Cab (4). Truck SuperCrew Cab (1). Van Cargo Van (4). Van G3500 Extended Cargo Van (1).
Jake Sweeney Chevrolet in Cincinnati | Dayton Chevrolet | Tri County
Sales - Call for Sunday Appts. Sales - Call for Sunday Appts. Sales - Call for Sunday Appts. New Chevrolet Model Offers. New Chevrolet Camaro Offers. New Chevrolet Cruze Offers. New Chevrolet Equinox Offers. New Chevrolet Malibu Offers. New Chevrolet Silverado 1500 Offers. New Chevrolet Model Offers. Air Conditioning Service Coupons. Auto Detailing Service Coupons. Check Engine Service Coupons. Coolant Flush Service Coupons. Oil Change Service Coupons. Wiper Blade Service Coupons. 335i xDrive Gran Turismo.
jakesweeneychryslerjeepdodge.com
Jake Sweeney Chrysler Jeep Dodge RAM | New & Used Car Dealer | Cincinnati, OH
Jake Sweeney Chrysler Jeep Dodge Ram. New Cars: 85 W Kemper RD Cincinnati, OH 45246. Used Cars: 135 Northland Blvd. New and Used Inventory. Financing and Trade-In Appraisal. Kelley Blue Book Trade-In. BBOL Value Your Trade. Mopar Parts and Service. Parts and Accessories Catalog. Express Lane Oil Change Service. Join our social network. ProMaster 2500 Cab Chassis. ProMaster 2500 Window Van. ProMaster 3500 Cab Chassis. 2014 Dodge SRT Viper GTS Coupe. 2014 Dodge SRT Viper GTS Coupe. Come on by Jake Sweeney ...
jakesweeneychryslerpaymentmatch.com
Jake Sweeney Chrysler Sales Event
85 West Kemper Road, Cincinnati. How can we contact you? GET A BETTER PAYMENT. ON A NEWER VEHICLE. What is your current payment? Months remaining in your finance/lease? What vehicle are you interested in? Your privacy is of utmost importance to us. Read More. By providing your personal information, you consent to its use and disclosure in accordance with our Privacy Policy. Therefore, it is important that you read and understand our privacy policy prior to providing any personal information about yourself.
Jake Sweeney FIAT Blog |
Jake Sweeney FIAT Blog. Visit Our Main Site. Jake Sweeney FIAT Blog. Visit Our Main Site. Get Trade-In Value Towards a FIAT Car. When you’re looking for new FIAT cars near Lexington, KY, consider heading to Jake Sweeney FIAT. Our customers receive the…. March 22, 2018. Get Pet Friendly with the 2018 FIAT 500L. Jake Sweeney FIAT knows that many Lexington, KY FIAT owners take their pets with them when driving. After all, why…. March 9, 2018. 2018 FIAT 124 Spider at Chicago Auto Show. February 20, 2018.
Custom Page
The Page Cannot be displayed. The page you are looking for is currently unavailable. The Web site might be experiencing technical difficulties, or you may need to adjust your browser settings.
Concesionario Alfa Romeo, BMW, Chevrolet, Chrysler, Dodge, FIAT, Jeep, Kia, Mazda y Ram en Cincinnati OH Autos Nuevo y Usado en Dayton en Jake Sweeney Latino
Búsqueda por marca y modelo. Todos los vehículos nuevos. Especial Vehículos para la venta. Conozca A Nuestro Personal. Todos los Vehículos Usados. Especiales de Vehículos Usados. Vehículos con un dueño. Vehículos de Menos de $10,000. Conozca A Nuestro Personal. Pregunta a un Técnico. Solicitud de retiro de vehículo. Conozca A Nuestro Personal. Conozca A Nuestro Personal. 135 Northland Blvd, Cincinnati, OH 45246. Numero de Telefono: 513-782-1115. Búsqueda por marca y modelo. Todos los vehículos nuevos.
Cincinnati Mazda Dealer | Jake Sweeney Mazda
Jake Sweeney Mazda Tri-County. 95 West Kemper Road. Get Pre-Approved in Seconds. Budget Buys Under $9995. Get Pre-Approved in Seconds. Buy Here Pay Here. Get Pre-Approved in Seconds. About Jake Sweeney Automotive. Jake Sweeney Mazda Social Network. Search by Body Style. Van LWB Passenger Van. 10,000 – $19,999. 20,000 – $29,999. 30,000 – $39,999. 40,000 – $49,999. Jake Sweeney Mazda Tri-County (317). Jake Sweeney Mazda West (254). Truck Crew Cab (2). Truck Standard Cab (1). Truck Super Cab (2). With a lar...
jakesweeneymazdacrazydeals.com
Invalid Link
The page you are looking for is no longer available. Http:/ www.jakesweeneymazdacrazydeals.com - WHOIS.
Jake Sweeney Mazda West | New Mazda dealership in Cincinnati, OH 45238
Jake Sweeney Mazda West. Get Pre-Approved in Seconds. Budget Buys Under $9995. Get Pre-Approved in Seconds. Buy Here Pay Here. Get Pre-Approved in Seconds. About Jake Sweeney Automotive. Jake Sweeney Mazda Social Network. Search by Body Style. Van LWB Passenger Van. 10,000 – $19,999. 20,000 – $29,999. 30,000 – $39,999. 40,000 – $49,999. Jake Sweeney Mazda Tri-County (317). Jake Sweeney Mazda West (254). Truck Crew Cab (2). Truck Standard Cab (1). Truck Super Cab (2). Truck SuperCrew Cab (2). 2012 Mazda M...