KAYLASMITH.NET
Kayla Smith | an irregular discussion on life in generalan irregular discussion on life in general
http://www.kaylasmith.net/
an irregular discussion on life in general
http://www.kaylasmith.net/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
0.8 seconds
16x16
32x32
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
BUY YOUR DOMAIN
11
YEARS
7
MONTHS
1
DAYS
WILD WEST DOMAINS, LLC
WHOIS : whois.wildwestdomains.com
REFERRED : http://www.wildwestdomains.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
15
SITE IP
192.0.78.24
LOAD TIME
0.797 sec
SCORE
6.2
Kayla Smith | an irregular discussion on life in general | kaylasmith.net Reviews
https://kaylasmith.net
an irregular discussion on life in general
kaylasmith.net
realizing your basically just like an ancient tribe | Kayla Smith
https://kaylasmith.net/2015/04/22/realizing-your-basically-just-like-an-ancient-tribe
An irregular discussion on life in general. Realizing your basically just like an ancient tribe. Just me waving ‘Hi’ from a corn field. photo creds to the ever-lovely H Mae.). Also, I just saw a motorcyclist drive past Starbucks with a GoPro on his helmet. $3 says he pulls some street trix tonight. I get distracted easily. I KNOW this God! I see and feel His active redemption in my life too! What are we supposed to drink? Then again, in chapter 17, the issue of water comes up again! Anyways, they move fr...
helper | Kayla Smith
https://kaylasmith.net/tag/helper
An irregular discussion on life in general. Kind of a weird title for a blog that is being published at the beginning of May instead of December, right? That was the best line I could come up with for the intro. First words are usually the hardest. Now that we’ve broken the ice I can get to it. I’ve been trying to remember God more intentionally, which sounds like a pretty strange concept, but stick with me. In the book “Cupid is a Procrastinator”. Have I ever mentioned that I can be a bit dramatic?
Scrooge | Kayla Smith
https://kaylasmith.net/tag/scrooge
An irregular discussion on life in general. Kind of a weird title for a blog that is being published at the beginning of May instead of December, right? That was the best line I could come up with for the intro. First words are usually the hardest. Now that we’ve broken the ice I can get to it. I’ve been trying to remember God more intentionally, which sounds like a pretty strange concept, but stick with me. In the book “Cupid is a Procrastinator”. Have I ever mentioned that I can be a bit dramatic?
Jesus | Kayla Smith
https://kaylasmith.net/tag/jesus
An irregular discussion on life in general. Bad for my soul. This one’s been stewing in my head for a couple weeks. I was in a coffee shop not long ago shootin the breeze with a friend, like ya do, and I mentioned a movie that I had recently seen. It was just bad. Just a bad movie. I saw things and heard phrases that shouldn’t have been exposed to my eyes and brain. As I said to my friend, “oooohhhh DON’T see that! It was NOT good! 8221; she responded with, “But did you think it would be? I can browse Pi...
misplaced contentment | Kayla Smith
https://kaylasmith.net/2015/05/13/misplaced-contentment
An irregular discussion on life in general. Warning: this blog will not fix your contentment issues. The following is an actual conversation that actually occurred between actual people. Their names have been changed to protect their privacy. 8220;I think I’m going to get my tragus pierced this weekend.” – Krayla. 8220;Isn’t that kinda dangerous? Just go skydiving instead.” – Whitley. 8220;….I think I’m just bored…” – Krayla. 8220;Mmmhhmmm…contentment.” – Whitley. I often find myself living this life of ...
TOTAL PAGES IN THIS WEBSITE
20
kaylasmediapoliticsblog.blogspot.com
Kayla's Blog
This Blog is for Politics and the Media. Monday, May 4, 2009. Unfinished Business - The New York Times. Today, I needed this one last blog post, so I went to The New York Times website in hopes of finding something interesting. This editorial piece. Stood out to me the most. It is talking about why Iraq is failing. It is perfectly clear from the beginning of the article that the author did not support Bush's war there (who did? Politics in Vernon, NJ. It struck me what a huge joke politics are in my ...
kaylasmidwaydirtkartracing.tripod.com
Home
S midway dirt kart racing. July 11th sign ups 5pm hot laps 6pm racing 7pm. Predator sealed engine class. Track is looking great for the first race, blacktop smooth! Forecast Provided by AccuWeather. Class Point standings 2014. Share this Dirt kart racing site with your friends. XA9; 2015, No Kart racers were harmed during the making of this video at Kayla's Midway Dirt Kart Racing. Just some pride hurt!
Build a Bearville Cheat Site! | BABV Cheats
Build a Bearville Cheat Site! New Room and Furniture for your Cub Condo. November 4, 2009. There is a new room you can buy for 3000 BearBills. And the new room is…. A DINING ROOM! LOL I don’t have a picture. and i’m too lazy to print screen. (: Also there are new furniture you can buy at the Bear Stuff Store! November 4, 2009. This months code is :. Picture taken from bearvilleinsider.com) — Credit. November 4, 2009. Maxine gives a Thanksgiving Float:. Miguel : Turkey Emote. Chloe : Orange Scarf. Well yo...
kaylasmiracle | My Wedding Blog
October 22, 2011. So, in case you’ve lost count (I have not! There are only 55 more days until Beau and I are married. So, if you’re wondering why I have not been posting it’s because I’ve been super busy with school (I’m am doing my internship) and wedding stuff. My mom has been fantastic, as usual, addressing invitations and setting up meetings, and she’s keeping me sane. Bedding, china, etc.). Cookwares, towels, etc.). Thank you all for putting up with me, and God bless! I have the best fiancee ever!
Kayla Smith | an irregular discussion on life in general
An irregular discussion on life in general. Have you ever seen the movie. If not, stop what you’re doing, go watch it, then come back and finish reading this blog. Awesome. Welcome back. That movie. So so much. It’s funny. It makes me feel good. And there’s finally an animated character other than Pocahontas that I can relate to. Her name is Sadness. One of my favorites to illustrate the point even further:. It’s long-term memory…you’ll get lost in there! It’s a gift, I tell ya. And here it is:. This doe...
KaylaSmith's blog - ✨ - Skyrock.com
10048; shawty ❀. 29/10/2014 at 11:16 AM. 19/03/2015 at 1:17 PM. Subscribe to my blog! Wednesday, 18 March 2015 at 11:08 AM. PAGE 1 : PRINCEACADEMYRPG. Posted on Tuesday, 10 February 2015 at 12:48 PM. Edited on Thursday, 19 March 2015 at 1:17 PM. Bang bang it's a shotgun love. Sympathique, souriante, adorable. Ayla Smith est une jeune femme plutôt calme, posée, même si. Elle est parfois un peu fofolle. Elle adore prendre soin des autres. Et est un peu trop gentille, même si elle peut devenir une vraie.
KaylaSmith722 (Kayla Smith) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Digital Art / Student. Deviant for 4 Years. This deviant's full pageview. Last Visit: 91 weeks ago. By moving, adding and personalizing widgets.
My Story
ATTENDING A REGULAR SCHOOL. When I was two or three years old, I started going to a day care center for the handicapped. There, I received physical therapy daily, and all the experts thought I would walk one day. I've always wondered if I had tried harder to do my exercises as I was growing up, would I be walking today? She apologized for hurting me and promised that she would stay in touch. We occassionly e-mail each other. Different individuals have helped me through difficult times, so maybe certain p...
kaylasmithdesignportfolio.wordpress.com
kaylasmithdesignportfolio | J210 Design Principles Portfolio
J210 Design Principles Portfolio. This shows textural gradient because through the use of the lily pads. The depth in the photo shows the gradient as the lily pads get further away. in this sense the detail is more prevalent in the front of the picture. September 30, 2014. This is an example of apparent movement because it is a collection of images that combines to show that of movement. It was done by Edward Muybridge and is a signifier for the beginnings of the motion picture. September 30, 2014. Follo...
SOCIAL ENGAGEMENT