KITCHENDESIGNGROUP.BIZ
Kitchen and Bath Remodeling | Akron, OHChoose the award-winning and experienced home remodeling experts when you contact Kitchen Design Group in Akron, OH, at (855) 752-1409.
http://www.kitchendesigngroup.biz/
Choose the award-winning and experienced home remodeling experts when you contact Kitchen Design Group in Akron, OH, at (855) 752-1409.
http://www.kitchendesigngroup.biz/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
Web.com -- eWorks xl
Domain Manager
12808 Gra●●●●●●●●●kway West
Jack●●●●ille , FL, 32258
United States US
View this contact
Web.com -- eWorks xl
Domain Manager
12808 Gra●●●●●●●●●kway West
Jack●●●●ille , FL, 32258
United States US
View this contact
Web.com -- eWorks xl
Domain Manager
12808 Gra●●●●●●●●●kway West
Jack●●●●ille , FL, 32258
United States US
View this contact
Web.com -- eWorks xl
Domain Manager
12808 Gra●●●●●●●●●kway West
Jack●●●●ille , FL, 32258
United States US
View this contact
BUY YOUR DOMAIN
REGISTER.COM, INC.
WHOIS : whois.neulevel.biz
REFERRED :
PAGES IN
THIS WEBSITE
4
SSL
EXTERNAL LINKS
0
SITE IP
216.21.224.199
LOAD TIME
0 sec
SCORE
6.2
Kitchen and Bath Remodeling | Akron, OH | kitchendesigngroup.biz Reviews
https://kitchendesigngroup.biz
Choose the award-winning and experienced home remodeling experts when you contact Kitchen Design Group in Akron, OH, at (855) 752-1409.
kitchendesigngroup.biz
Kitchen and Bath Remodeling | Akron, OH
http://www.kitchendesigngroup.biz/other-rooms.html
843 N Cleveland Massillon Road, Akron, OH 44333. By Web.com Group, Inc.
Bathroom Remodeling, Home Renovations | Akron, OH
http://www.kitchendesigngroup.biz/Home-Renovations-Akron-OH.html
843 N Cleveland Massillon Road, Akron, OH 44333. Expert Bathroom Remodeling and Home Renovations in Akron, Ohio. When you contact Kitchen Design Group in Akron, Ohio, your bathroom remodeling and home renovations turn out exactly as you wanted. Make the choice to provide your family and guests with a flair for detail and perfection. The Best Bathrooms Possible. Take advantage of our unique skills for all your remodeling needs for other room such as offices, entertainment centers, wet bars, and closets...
Kitchen Remodeling, Granite Countertops | Akron, OH
http://www.kitchendesigngroup.biz/Granite-Countertops-Akron-OH.html
843 N Cleveland Massillon Road, Akron, OH 44333. Elegant Kitchen Remodeling with Granite Countertops in Akron, Ohio. Enjoy the best in kitchen remodeling services, complete with granite countertops, by calling Kitchen Design Group in Akron, Ohio. Let us put the mark of truly well-designed and handcrafted distinction on your kitchen renovations, from the appliances to the countertops and right down to the flooring. Bull; Moen™. Bull; Delta™. Bull; Corain™. Bull; Cambria™. Bull; Sub-Zero™. Bull; Wolf™.
Home Remodeling | About Us | Akron, OH
http://www.kitchendesigngroup.biz/Home-Remodeling-About-Us-Akron-OH.html
843 N Cleveland Massillon Road, Akron, OH 44333. Welcome to Kitchen Design Group. Was formed in late 2000. Our purpose is to provide quality kitchen and bath products and competent professional design services to our clients in West Akron, Hudson, and the surrounding counties of Northeast Ohio. We work very hard to maintain the level of quality and service that our clients are proud of. From left to right, the partners of Kitchen Design Group are Barbara Dillick, Deanna Carleton, and Bob Kieft.
TOTAL PAGES IN THIS WEBSITE
4
Kitchen Design Gallery – Cabinets, Counter Tops, and More.
Cabinets, Counter Tops, and More. Cabinets and Countertops to Fit Your Lifestyle. New Kitchen and Bathroom Construction or Remodeling. Our designers will work with you to create your dream kitchen or bathroom. We provide full design services that will help you with everything from creating the floor plan of your kitchen or bathroom, to assisting you in choosing colors and finishes. Choose from two different cabinet lines and several types of countertops. Cabinets, Counter Tops, and More. Monday 9am - 5pm.
Kitchen Plans UK | NOT the cheapest kitchens in Kent.
NOT the cheapest kitchens in Kent. Why talk to us? You might be in the earliest stages, or you might have a design already. We don’t play beat this quote : if the quality's not important, we're not for you. However. If you’d like a better kitchen than the superstores', but you don’t want to pay 40k or 50k at an independent studio, e-mail us now. That’s how easy it is. It’s just a kitchen. Send us your design! Divslides" data-cycle-timeout="5000" data-cycle-prev="#sliderprev" data-cycle-next="#slidernext".
Kitchen Cabinet Glass by Cascade Crystal
THE DESIGN GLASS PROFESSIONALS. Glass cabinet doors are an important central element in a well designed kitchen. As a natural focal point, they are the perfect way to enhance your kitchen. For a small investment, you can transform and enliven the whole look of your kitchen by replacing the glass or substituting glass panels for solids. Call for a consultation. Our custom glass is easy to order and surprisingly affordable! Takes about 2 weeks. Click here for ordering information. To order: 877 318-5702.
James Kitchens - The Quality Cabinet Makers
The Quality Cabinet Makers. Kitchen Renovation Specialists View Gallery. James Kitchens is located in Nerang, Gold Coast and has been in business since 1980. We’ve recently brought our kitchen design expertise to the Brisbane area. Our range of kitchens feature the latest in contemporary designs and finishes. We offer a solution to all your kitchen, bathroom, cabinets and renovation needs. A Showroom for colour and product selection. A personalised and friendly approach to kitchen design. We have teamed ...
kitchendesigngrandrapidswestmichiganlifestylekitchenstudio.com
This site is under development
This site is under development. This page indicates the webmaster has not uploaded a website to the server. For information on how to build or upload a site, please visit your web hosting company's site.
Kitchen and Bath Remodeling | Akron, OH
843 N Cleveland Massillon Road, Akron, OH 44333. Award-Winning Kitchen Design and Remodeling in Akron, Ohio. Why Should You Choose Kitchen Design Group for Your Next Kitchen or Bathroom Remodeling Project? So, if you are planning an extensive remodel of a kitchen or bathroom, or just an update of a tired kitchen, adding new granite countertops or a kitchen island, please call Kitchen Design Group for the best solution to your remodeling needs. Learn More about Kitchen Design Group. Or a man cave? For gui...
Kitchen Design Group
Specializing In Residential Kitchen And Bath Design. Designs by Caren Rideau.
IIS Windows Server
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
Kitchen Design Guide | Save Money on Kitchen Remodeling!
Save Money on Kitchen Remodeling. Why use KitchenDesignGuide.org? Get free quotes from up to four local contractors. All of our contractors are pre-screened, licensed, and insured. No obligation to buy. When contractors compete for your business, you save money! Need Kitchen Remodeling Leads? Do you need to remodel or renovate your kitchen?
Kitchen Design Guru | New Design Ideas and Trends
Kitchen Trends & Inspiration. Learn how to Boost your Bathroom. Posted on Jan 25, 2014 in DIY Projects. There’s nothing more depressing than finding broken tiles, split linoleum and bathroom vanity handles coming off in your hand. Why White is Always Right in the Kitchen. Posted on Jan 24, 2014 in Kitchen Trends and Inspiration. Fancy an all-white kitchen? That’s one with white kitchen cabinets, white kitchen countertops and white tiling too? How to Remodel your Bathroom on a Budget. It’s not all t...
