LIVESIMPLYLIFE.WORDPRESS.COM
live simply | live simply. that's it.live simply. that's it.
http://livesimplylife.wordpress.com/
live simply. that's it.
http://livesimplylife.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
0.2 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
5
SSL
EXTERNAL LINKS
21
SITE IP
192.0.78.13
LOAD TIME
0.2 sec
SCORE
6.2
live simply | live simply. that's it. | livesimplylife.wordpress.com Reviews
https://livesimplylife.wordpress.com
live simply. that's it.
livesimplylife.wordpress.com
It’s still Flannelberry Friday | live simply
https://livesimplylife.wordpress.com/2013/09/14/its-still-flannelberry-friday
A wee miss calculation →. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday. No, I didn’t forget. I actually had so many things I wanted to post about that I couldn’t decide what to actually post. That and the fact that there is a frog living in my greenhouse that I wanted to get a picture of. Evidently s/he isn’t as into Flannelberry Friday as I might like because when I had the option of a picture, s/he wouldn’t come out of hiding. Here it is peeps. A wee miss calculation →. You are commenti...
Yep – I’m building these | live simply
https://livesimplylife.wordpress.com/2014/03/20/yep-im-building-these
A wee miss calculation. March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. A wee miss calculation. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Notify me of new comments via email.
A wee miss calculation | live simply
https://livesimplylife.wordpress.com/2013/09/14/a-wee-miss-calculation
It’s still Flannelberry Friday. Yep – I’m building these →. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. It’s still Flannelberry Friday. Yep – I’m building these →. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). A wee miss calculation.
A little rain and some fry bread | live simply
https://livesimplylife.wordpress.com/2013/07/29/a-little-rain-and-some-fry-bread
July 29, 2013 · 4:21 pm. A little rain and some fry bread. A little rain is falling and I couldn’t be more grateful. We’re in the full swing of summer squirelling for winter enjoying. Apricots were last night, cherries the night before. While I love the end result of canning, the sticky, sweet heat can get to you after a while. This cleansing rain is just the thing. And to go with it, because I didn’t make “real” bread because of the heat, we have fry bread:. Leave a Reply Cancel reply. Middot; live simp...
live simply | live simply. that's it. | Page 2
https://livesimplylife.wordpress.com/page/2
Newer posts →. May 18, 2013 · 8:01 pm. Tea and lots of it. We drink a lot of tea in this house. By a lot I mean epic amounts. A pot in the morning before work (per person) would not be out of the ordinary. Imagine my surprise when I learned why my tea bags don’t decompose:. Http:/ alice-in-blogland.blogspot.ca/2007/05/composting-tea-bags.html. Http:/ www.zerowastescotland.org.uk/content/food-grade-recycled-polypropylene-pp-packaging-0. Http:/ www.care2.com/greenliving/tea-bags.html. We used coconut oil t...
TOTAL PAGES IN THIS WEBSITE
5
People who cook -
http://www.flannelberry.com/home/people-who-cook
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). So, I love Becoming Minimalist - the blog. There is soooo much good information there. And usually, I want to forward almost everything to everyone. But today, today is different. Today I'm going to argue with a hugely misguided post. So first of all, this is a guest post from the folks at Minimalist Baker. Let me follow their post and explain. There's a story (isn't there always? And it's a great mil...
Blog Posts -
http://www.flannelberry.com/home/previous/2
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). The good of it is, before kidding starts and the garden is in full swing, I have a chance to pay down some of the debt I took on getting the store started. And, while I'm a big fan of not getting too into the workaholism thing these days, I can dust off my former workaholic self when I need to. But, today, in spite of the business this week, the light at the end of the tunnel is a-shining! So, when yo...
Blog Archives -
http://www.flannelberry.com/home/archives/04-2015
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). This lifestyle is such hard work. Not my goat but how cute. Check out the Eden Hills blog, lots of great info there. I have so appreciated the notes sent through the contact us page but there are two themes emerging that I would like to address. Conveniently, they relate to each other. The first is: I think you're advocating for simpler, sustainble living but it's such hard work. How do you do it?
Category: Arugula -
http://www.flannelberry.com/home/category/arugula
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). The greenhouse and sprouts! Those of you who are gardeners already know what this really means. It's exciting and lovely and so wonderful. It also means we're going to be eating a lot of greens (and peas) very soon. The first few salads are going to be wonderful and then. So, some of these ideas weren't right up my alley but this one. It's garden season everyone! Gardening In Dry Conditions.
Exhausted? Try this. -
http://www.flannelberry.com/home/exhausted-try-this
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). 1) Take your shoes off. Ideally, you'll read this in warm and not too wet weather and you'll take your shoes off outside and walk barefoot in some grass, or a garden, or somewhere that you can really feel the earth. Are you parenting/caregiving? If so, take the people you care for to walk in the grass with you. I learned about this from my cousin, the Cranky Daoist. Try this next one. No room for them...
Vegetable garden - autumn style -
http://www.flannelberry.com/home/vegetable-garden-autumn-style
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). Vegetable garden - autumn style. Sad, dying plant. Just what I hope to prevent. Now I don't know about you but here we re having a major drought. Summer came early and it came hard. I have raspberries ripening about two weeks ahead of schedule and lacking about two week's worth of flavour. Bummer. Everything's kind of like that this year too. Beautiful kale - also a cool blog. Check it out. While I am...
Blog Archives -
http://www.flannelberry.com/home/archives/05-2015
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). No kill farms, really? So, this weekend I had the good fortune to be asked about my little farm. The person who asked was considering keeping a few chickens and wanted to know more about them in particular. As is too often the case, the conversation came around to "do your chickens hatch? And then "do you kill the roosters? The obvious one for me, when talking about poultry (which we all know is a gat...
Blog Archives -
http://www.flannelberry.com/home/archives/03-2015
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). I love you so. Not only do I love you as part of something yummy, I also love the way your green shoots bring such hope when nothing else has started. As soon as the fire is going, the second kettle goes on. It takes a while to heat up on the stove (from the stove being cold - it's not that slow when the stove is hot). 3) Boiling water is poured over the tea into the warmed pot. They soaked for 12 hou...
Category: Autumn -
http://www.flannelberry.com/home/category/autumn
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). There's so much going on in the World today. I'm sure, like most of the world, it seems that there's a lot of heart ache and not a lot of hope that humanity can overcome the sorrows it keeps inflicting on itself. So, every time you feel a bit of sorrow or overwhelmed or whatever else it is that sells news, take a minute to counteract that with gratitude. Your brain will thank you. So many decisions an...
What fun -
http://www.flannelberry.com/home/what-fun
Ramblings (aka the Blog). Disclaimers, disclosures, and all of that. Live Simply (with the goat corral). The first crop of chicks were a surprise. Momma just arrived with eight chicks in tow. Cornish hens, gotta love them! I'm a 40-something writer, parent, fibre artist, and smallerholder living in the wilds of BC with my family, our small herd of Nigerian Dwarf Goats, chickens, ducks, dogs, and cats. Gardening In Dry Conditions. Nigerian Dwarf Goats For Sale. Proudly powered by Weebly.
TOTAL LINKS TO THIS WEBSITE
21
livesimplyhitomijournal.wordpress.com
Live Simply Hitomi's journal – I am a yogi who loves chocolate and coffee.Here I share with you about me, my travels, my life journey
Live Simply Hitomi's journal. I am a yogi who loves chocolate and coffee.Here I share with you about me, my travels, my life journey. Follow Blog via Email. Enter your email address to follow this blog and receive notifications of new posts by email. Follow Live Simply Hitomi's journal on WordPress.com. Our Yoga retreat website. Our Yoga retreat website. View eyehitomi’s profile on Pinterest. January 3, 2016. December 7, 2015. Magazine “Yogini”. December 7, 2015. Our new jewelry brand “Edomi”.
Live Simply Horticulture
Live Simply Horticulture is not just a service to you and your loved ones. It's a way of life. Phone Lindsay @ 902.956.8570. Let us give your lawn the attention it needs. From building, planting, watering and weeding, we've got it covered! Have shrubs or trees in need of a pruning? Dead patches in your lawn? We are a registered dealer with Hannas Seeds (AB residents only). Currently working on becoming a Registered Horticulture Therapist!
livesimplyintheworld.wordpress.com
Simply Green | Living Simply, Living Green & Saving Money
Living Simply, Living Green and Saving Money. Saving Money with Organic Foods. April 26, 2010. You CAN save money and eat healthy, earth conscious foods! It’s so simple I can’t believe I didn’t think of it before! Here is the secret:. Switch to a plant-based diet. That’s it…. Apparently, and I just learned this new word last week, a flexitarian is someone who eats mostly a plant-based diet but isn’t opposed (morally or otherwise) to eating meat on the occasion. 18 lb for fresh caught wild Salmon, $7....
Live Simply Health Journals
Documenting your child’s Wellness Checks is going to be easy when using this section of the journal. The basic information given during these checks can be quickly documented while at the visit with your child’s doctor. We’ve made certain to include height, weight and even a space to write their percentile for each so you can make sure your child is on track. South Phoenix Healthy Start - Phoenix, AZ. Moonbeams - The Shops at Gainy Ranch - Scottsdale, AZ. Write Ons Etc. - Phoenix, AZ. This would make an ...
live simply | live simply. that's it.
March 20, 2014 · 6:48 pm. Yep – I’m building these. Even though our garden is well fenced, we always have interlopers. Perhaps these…. Http:/ www.grit.com/farm-and-garden/building-garden-fence-boxes.aspx#axzz2wWvo24jZ. September 14, 2013 · 2:21 pm. A wee miss calculation. Anyway, I have no shortage of things to do today. And tomorrow we’re butchering meat birds (so long as the wasps aren’t posing a problem). It will be a very full weekend. September 14, 2013 · 1:56 am. It’s still Flannelberry Friday.
live simply and simply live
Monday, June 20, 2016. Olive Miriam Asay joined our family on February 2, 2016 at 1:05 pm. She weighed 7 lbs 10 oz and was 20 inches long. If that date sounds familiar that's because it is- Olive shares a birthday with big sister, Scarlett. What was I supposed to do for 4 hours? Created by kira lee. Saturday, December 27, 2014. Created by kira lee. Labels: chaotic family togetherness. Wednesday, August 20, 2014. Where the heart is. Created by kira lee. Labels: chaotic family togetherness. On the fourth o...
livesimplylivehealthy.com
Welcome to: livesimplylivehealthy.com. This Web page is parked for FREE, courtesy of GoDaddy.com. Search for domains similar to. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
livesimplylivethriftylivesavvy.com
Live Simply, Live Thrifty, Live Savvy | Life Lived Better
Live Simply, Live Thrifty, Live Savvy. About ‘Live Simply, Live Thrifty, Live Savvy’. Awards & Accolades. Let’s Get in Touch! 3 Health Benefits of Eating Soups. I’m very excited to announce that we have a guest blog post. However, eating soup on a regular basis doesn’t just protect you from a runny nose; there are various health benefits of this tasty meal. So, clear or thick, eating soups is beneficial for your well-being and we’ve taken it upon ourselves to note these 3 major health benefits of sou...
Live Simply Love
What I Brought Into Marriage. October 24, 2013. If you’re new here, you may want to subscribe to my RSS feed. Thanks for visiting! In ancient times (and even today in some parts of the world), a bride brought a dowry usually property belonging to her parents into a marriage. The intent of a dowry was to provide future support for the bride and her children […]. My Gift to the World. October 15, 2013. Writing, Feeling God’s Pleasure and the Unintended Sabbatical. August 30, 2013. September 19, 2012. Augus...
livesimplylovedeeply.wordpress.com
:: live simply :: love deeply ::
Live simply : love deeply :. Take a walk with me. Vulnerability and enemy love. January 24, 2014. I hear echoes of the tune’s melody, and I wonder what act of love, as simple as a few notes played on a trumpet, might lift me out of anger, out of hatred, and into the fullness and grace of love.”. 8212; Mariah Heglson (Commentary on the video above). September 8, 2013. So, i’m here in Vancouver with the Servants team. Orientation is starting tomorrow. In this shared language i don’t have to have a th...