
MAKELEMONADE.BE
Make Lemonade | Bringing entertainment in the wasteland of advertising contentWe are a creative agency based in Leuven bringing entertainment in a wasteland of repetitive advertising content.
http://www.makelemonade.be/
We are a creative agency based in Leuven bringing entertainment in a wasteland of repetitive advertising content.
http://www.makelemonade.be/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.2 seconds
16x16
32x32
64x64
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
3
SITE IP
91.223.195.219
LOAD TIME
1.24 sec
SCORE
6.2
Make Lemonade | Bringing entertainment in the wasteland of advertising content | makelemonade.be Reviews
https://makelemonade.be
We are a creative agency based in Leuven bringing entertainment in a wasteland of repetitive advertising content.
Eigen Kweek | Make Lemonade
https://www.makelemonade.be/work/eigen-kweek
Eigen Kweek Make Lemonade. Make Lemonade Digital and Publicity Agency - 32 (0)16 888 005. 32 (0)16 888 005. Eigen Kweek is a hugely successful TV drama about a Flemish peasant family opting into the cannabis trade to make ends meet. To October, 2014. Koning Leopold I-straat 18 3000 Leuven. 32 (0)16 888 005. A website by Minsky.
News | Make Lemonade
https://www.makelemonade.be/news
Make Lemonade Digital and Publicity Agency - 32 (0)16 888 005. 32 (0)16 888 005. At Make Lemonade, we value content and imagination over scale and prestige. When we’re hiring, we want likeminded people. Full article. 3 Golden and a Silver at the Davey Awards in NY. The jury selected the best entries among nearly 4000 submissions from independent agencies worldwide. We won 2 gold awards for our Nike SB film ‘ Brotherhood Of The Feet. Make Lemonade puts it in plain language for KBC Bank. In NY Full article.
Friends Forever | Make Lemonade
https://www.makelemonade.be/work/friends-forever
Friends Forever Make Lemonade. Make Lemonade Digital and Publicity Agency - 32 (0)16 888 005. 32 (0)16 888 005. For children's clothing brand Filou and Friends, we wanted to move away from the usual formula of picture-perfect kids showing off clothes. We carefully casted real kids via the brand's Facebook page and filmed them behaving like the kids they are. Koning Leopold I-straat 18 3000 Leuven. 32 (0)16 888 005. A website by Minsky.
Literary Wednesdays | Make Lemonade
https://www.makelemonade.be/work/literary-wednesdays
Literary Wednesdays Make Lemonade. Make Lemonade Digital and Publicity Agency - 32 (0)16 888 005. 32 (0)16 888 005. De Morgen wanted a radio spot to announce the move of their book supplement to Wednesdays. Henceforth, Wednesday becomes. When the use of fancy words and citations is allowed. Literary Wednesdays - radio. To August, 2014. Koning Leopold I-straat 18 3000 Leuven. 32 (0)16 888 005. A website by Minsky.
Olympia | Make Lemonade
https://www.makelemonade.be/work/olympia
Make Lemonade Digital and Publicity Agency - 32 (0)16 888 005. 32 (0)16 888 005. Canvas held the exclusive broadcasting rights to the 2012 Olympic Games. The event drew in a great number of occasional viewers. A perfect opportunity to show them what Canvas is all about. After the Olympic Games, the reality of the unfolding economic crisis would come back into focus. And Canvas would be there to cover it. We also created a series of banners linking current news events to the London Olympics.
TOTAL PAGES IN THIS WEBSITE
20
advertising | alina kneepkens
https://alinakneepkens.net/advertising
PORTFOLIO freelance director and journalist. Client: Vrouwenraad and Amazone. To view the videos below, send me an e-mail. Cobra’s Classic Battle. Creative Director: Willem Van den Hoof. Tv producer: Simon Vrebos. Sound mix: MM studio. Camera Assist: Jean Gonzales. Assistent Production: Tine Tubbax. Client: VRT, Cobra.be. Concept and director: Alina Kneepkens. Production: Inge De Keersmaeker. Dop: Teun Poppe Entourage. Sound: Jeroen De Vriese Entourage. Editing: Jan Vanderweken Kandenza. Jan on Over Eten.
Realisaties | MINSKY » Webdesign & Drupal websites uit Leuven
https://www.minsky.be/realisaties
Ga rechtstreeks naar de hoofdnavigatie. De zomer is van Mechelen. Concept and Lead: Make Lemonade. M - Museum Leuven. Website Manhattn's Burgers. Campagne / PR: Make Lemonade. Ontwerp en ontwikkeling website SLAC. De zomer is van Mechelen. HORST Arts and Music festival. OPRECHT.MECHELEN. website. Ga naar de website. Kan je er niet genoeg van krijgen? Door onze projecten gescrolled? Dan ben je zeker onder de indruk. Neem gerust contact op als we ook voor jouw nieuwe website mogen bouwen.
TOTAL LINKS TO THIS WEBSITE
3
makelelemusic59's blog - Blog de makelelemusic59 - Skyrock.com
More options ▼. Subscribe to my blog. Created: 19/01/2017 at 11:02 PM. Updated: 19/01/2017 at 11:24 PM. Ici vous allez pouvoir suivre notre actualités. Rien que pour vous des artistes rap et autres du nord. Clips, sons, photos, interviews, freestyles. M K B - Ciroc Amnésia. Add this video to my blog. M K B - Ciroc Amnésia. Posted on Thursday, 19 January 2017 at 11:25 PM. Add this video to my blog. Posted on Thursday, 19 January 2017 at 11:24 PM. M K B - C.N.S. Add this video to my blog. Don't forget that...
makelelesystems-landscapedivision.com
Makelele Systems
Blog de makelelette - . Gabrielle est heureuse . * - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Gabrielle est heureuse . *. Mon bonheur à l'état pur,. Ma plus belle histoire d'amour,. Mes plus belles rencontres,. Depuis quatre ans :. Lisa and Florie . :D ♥. Mise à jour :. Abonne-toi à mon blog! Gabrielle . 15ans . o6.1o . LesMeilleures. Ou poster avec :. Retape dans le champ ci-dessous la suite de chiffres et de lettres qui apparaissent dans le cadre ci-contre. Posté le mercredi 03 décembre 2008 11:22. Modifié le samedi 14 janvier 2012 14:32.
www.makelemon8.com
One Dimension
See, that’s what the app is perfect for. Wahhhh, I don’t wanna. We are mature in one realm, childish in another. Do You Ever Feel Like You Don’t Belong Here? Do you ever feel like a misfit, a renegade or a maverick? Like somehow you don’t belong here on this Earth? Nov 8th, 2016. Nov 8th, 2016. Nov 8th, 2016. Nov 8th, 2016.
Make Lemonade | Bringing entertainment in the wasteland of advertising content
Bringing entertainment in the wasteland of advertising content since 2012. 6 months 1 week. Lore Debulpaep returns to her hometown, Leuven, where she started her career in 2009. After working for Boondoggle, (afterworking) in Cape Town and back to working for Famous Grey, she has come home to Make Lemonade. Her no nonsense approach, DIY attitude and her solid organisational skills will make her Make Lemonade’s leading lady. Welcome! 6 months 1 week. The new voice of Make Lemonade. 6 months 1 week. Nailin...
Make Lemonade
Great food for everyday people. From the Kids 2. When A Creature Was Stirring…. Time To Take Stock. Changing the Negative Tapes. Great food for everyday people. Great food for everyday people. From the Kids 2. Make lemonade came about after life had thrown our family a lot of lemons in a short space of time. It started on July 8th…. Christmas seemed a little crazier for us this year with a lot of coming and going and a rather large household to feed. Often in…. When A Creature Was Stirring…. Even though ...
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
Large Group Dynamics | Learning to live together wisely
Learning to live together wisely. Charleston Massacre Blamed on Anti-Intellectualism. McKinney Pool Party – Fox Hannity Discussion, June 9. McKinney Pool Party – Analysis. Welcome to the Large Group Dynamics blog. This blog is about how people behave in large groups. People cooperate on a massive scale to achieve many wonderful things but we have also seen terrible wars and ongoing international and domestic conflicts. For more information about LGD and this blog please visit “ About LGD. 8220; Please pr...
Make Lemonade
Your browser does not support the video tag. 701 N SHIPLEY ST WILMINGTON, DE. 5 PM - 8 PM. 100 delirious studio dance parties. 55 hours in the air. 1,000 instances of thinking about whales. 1 bazillion hours of earspiration. Age for 22 years. 85 nights on the couch. 12,364 ounces of whiskey. 64,853 pieces of dog fur. London was the best thing that I experienced during VC. It brought people that I never thought I would be friends with close to me, and it brought my original friends even closer. Take notes...
makelemonadeclothing.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.