MINERALCREATIONS.BLOGSPOT.COM
Mineral CreationsCustom Lapidary and Wire Sculpted Jewelry
http://mineralcreations.blogspot.com/
Custom Lapidary and Wire Sculpted Jewelry
http://mineralcreations.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
0.3 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
13
SITE IP
172.217.12.161
LOAD TIME
0.297 sec
SCORE
6.2
Mineral Creations | mineralcreations.blogspot.com Reviews
https://mineralcreations.blogspot.com
Custom Lapidary and Wire Sculpted Jewelry
mineralcreations.blogspot.com
Mineral Creations: Park Silly Market 2011
http://mineralcreations.blogspot.com/2011/07/park-silly-market-2011.html
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. Saturday, July 16, 2011. Park Silly Market 2011. We would like to thank all of the visitors to our booth at the Market. This year. We are having a lot of fun visiting with old friends and new visitors to the market. Please feel free to contact us if you would like anything that you have dreamed about after your visit. Please e-mail us at info@mineralcreations.com. Subscribe to: Post Comments (Atom). View my complete profile.
Mineral Creations: Jewelry Care
http://mineralcreations.blogspot.com/p/jewelry-care-sterling-silver.html
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. Congratulations on your purchase of a one of a kind hand crafted piece of sterling silver jewelry from Mineral Creations. Many hours of time and careful craftsmanship are spent on each piece of jewelry, to ensure you receive the highest quality product. Fine quality jewelry is made to last a lifetime. Proper caring and storing of your jewelry will ensure that you will be able to wear and enjoy it for years to come. The jewelry should...
Mineral Creations: May 2013
http://mineralcreations.blogspot.com/2013_05_01_archive.html
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. Sunday, May 5, 2013. Come Visit this Summer. We would like to welcome all of our friends to our new home this summer.the Wasatch Front Farmer's Market. At Gardner Village. We are looking forward to meeting everyone at this great venue in West Jordan, Utah. Located at 1100 West and 7800 South, Gardner Village has been a favorite shopping spot for our family for many years. Gardner Village Farmer's Maket. Links to this post.
Mineral Creations: Thansgiving 2014
http://mineralcreations.blogspot.com/2014/11/thansgiving-2014.html
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. Thursday, November 27, 2014. As I reflect on this past year and the many events that have shaped my life, I am left feeling grateful for some of the simple items and images that my mother and aunt gave me each Thanksgiving. My brothers and I used the day to relax and play - we grew up with each other as our most frequent playmates. Vintage Whole Conch Shell Cameo. Labels: 14 kt gold fill. Hand Carved Shell Cameo. Riverton, UT 84065.
Mineral Creations: Return Policy
http://mineralcreations.blogspot.com/p/return-policy.html
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. If for any reason you are dissatisfied with an item that you purchased from us you can return it within 14 calendar days for a full refund of the purchase price of the item. (Custom Orders that have not been paid in full will only be refunded the deposit paid toward their item.) We will not refund any shipping, handling, or insurance charges. Please pack all returns securely and insure the package accordingly. Once we receive your re...
TOTAL PAGES IN THIS WEBSITE
19
Custom Pendants - Mineral Creations
http://www.mineralcreations.com/custom-pendants.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Sterling Ammonite Pendant and Earring Sets. Will custom make per order. Range from 0.50" - 1.00" in diameter for each half. Will custom make per order. Pendant Only $20.00 USD. Earrings Only $25.00 USD. Pendant and Earring Set $43.00 USD. Custom Wire Sculpted Pendants. 14 kt Rolled Gold. The elegant swirls surrounding the bail of this piece wrap both sides allowing both sides to be shown as "up." This stone is from the Congo, Africa. - $ 115. One of a Kind.
Heart Pendants - Mineral Creations
http://www.mineralcreations.com/heart-pendants.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. We hand cut each of these hearts to be approximately 30 mm x 30 mm (1.25" x 1.25") and then attach a solid sterling silver bail. Each heart is unique, and the size of each stone varies slightly so that the symmetry of the heart shape can be maintained. Astorite - San Juan, CO. 30x30 $35.00 USD. Manti-La Sal National Forest, Utah. We gathered this material from above the abandonded town of Thistle, Utah. During the 1980s a large portion of the mountain...
About the Artists - Mineral Creations
http://www.mineralcreations.com/about-the-artists.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Mineral Creations - The Jewelry of Hard Rocks. Custom Designed by Karyn and Robert. We formed Mineral Creations in 2008 as a way to share the peace and creativity we have found while discovering and creating our jewelry. Hand cut stones and artistically sculpted wire settings are the centerpiece of our business. For an updated list of events.
Jewelry Care - Mineral Creations
http://www.mineralcreations.com/jewelry-care.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Care and Storage of Fine Jewelry. Frequent cleaning is recommended to maintain the true beauty of your jewelry. Salt water, chlorine in swimming pools, soap and perspiration take their toll on all fine jewelry. Be careful when working with household cleaners with bleaches and ammonia and remove all jewelry. Wipe your jewelry carefully with a soft cloth to keep it clean and free of these elements which oxidizes. Avoid prolonged contact with wood, since som...
Gemstone Jewelry - Mineral Creations
http://www.mineralcreations.com/gemstone-jewelry.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Single Stone Gemstone Pendants -. Single Stone Pendant - Silver or Gold. Each pendant is custom made with a lab created 6 mm heart shaped gemstone. Due to the the variations in construction, each piece will be slightly different from what is pictured, but will be a quality crafted pendant. We create no two pendants exactly alike. Single stone pendants range from 1 1/4" - 1 3/4" tall and are from 5/8" wide to 1" A larger heart like Emerald is 1 3/8" wide.
Birthstone List - Mineral Creations
http://www.mineralcreations.com/birthstone-list.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Birthstones for Faceted Gems.
Shipping and Returns - Mineral Creations
http://www.mineralcreations.com/shipping-and-returns.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. We ship our items via the USPS. Other shipping methods are available upon request. Please contact us directly at info@mineralcreations.com. If you would like a quote on alternative shipping methods. Overnight (aka Priority Mail Express) is available upon request and rates are listed below. HOLIDAY SPECIAL - September 1, 2015, to January 31, 2016. FREE SHIPPING on all orders $30 or more. Postal Deadlines (ordering by postal deadlines does. For a full refun...
14 Karat Rolled Gold - Mineral Creations
http://www.mineralcreations.com/14-karat-rolled-gold.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. 14 Karat Rolled Gold - "Gold of the Future". How is Rolled Gold Filled Made? Rolled Gold also known as "gold filled" is made by fusing a layer of Karat Gold to a suitable supporting metal (or alloy) using equipment that carefully controls pressure, heat, and time. The bond produced is a permanent one. Electroplating is NOT a part of this process. Rolled Gold wears like solid gold because its outer surface is solid gold.
Accessories - Mineral Creations
http://www.mineralcreations.com/accessories.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Black Leather Cord - 1.5 mm. 16 $10.00 USD. 20 $12.00 USD. 24 $15.00 USD. This leather cord necklaces is manufactured in the USA and has sterling sliver end caps. X-Large (5 x 3) $7.00 USD. Large (4.25 x 2.5) $6.00 USD. Medium (3.2 x 2) $5.00 USD. Small (2.2 x 1.5) $3.25 USD. Note: When bending the steel wire, use two pliers so as to not pull the wire from the base.
Materials - Mineral Creations
http://www.mineralcreations.com/materials.html
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. Congratulations on your purchase of a one of a kind hand crafted piece of jewelry from. Many hours of time and careful craftsmanship are spent on each piece of jewelry, to ensure you receive the highest quality product. Fine quality jewelry is made to last a lifetime. Proper caring and storing of your jewelry. Will ensure that you will be able to wear and enjoy it for years to come. 14 Karat Rolled Gold/Gold Filled. Click to set custom HTML.
TOTAL LINKS TO THIS WEBSITE
13
Mineralcraft
Mineral Craft North Ltd
Items: , Value:. Bus & Railway Photographs (R). Transport Memorabilia & Ephemera (R). Tumble Stones (W). Jumbo Tumble Stones (W). Rough Rock (W). Rough Rock - Specials/One offs (W). Specimen Pieces (W). Tumble Polishing Supplies, Blades etc. (R). Cabochons (R). Faceted Stones (R). Stone Dishes (R). Agate Slices & Stands. Stone Slices (R). Agate Slabs & Bookend Pieces (R). Fossils etc. (R). Crystals & Crystal Beds (W). Shells (R). Jewellery Components (R). Stone/Shell Shapes for Jewellery (R). MINERAL CRA...
MineralCream.com is available at DomainMarket.com
Ask About Special April Deals! What Are the Advantages of a Super Premium .Com Domain? 1 in Premium Domains. 300,000 of the World's Best .Com Domains. Available For Immediate Purchase. Safe and Secure Transactions. 24/7 Customer Support: 888-694-6735. Search For a Premium Domain. Or Click Here To Get Your Own Domains Appraised. Find more domains similar to MineralCream.com. We are constantly expanding our inventory to give you the best domains available for purchase! Domains Added in the Past Month.
Mineral Creations
14 Karat Gold Filled. What Can I Wrap For You? Gallery - Sample Pieces. Saturday, October 31, 2015. There are only a few weeks left before another year has ended and I am looking forward to making new memories that will last as poignantly as those that have stirred tonight. Links to this post. Labels: 14 kt gold fill. Hand Carved Shell Cameo. One of a kind. Thursday, November 27, 2014. Vintage Whole Conch Shell Cameo. When working with cameos, I try to keep in mind that there are two artists hands on eve...
Home
Cameos and Vintage Jewelry. 14 Karat Rolled Gold. All Items are Designed and Handcrafted. By Robert and Karyn. Cameos and Vintage Creations. Roan Leopard Marble - Utah. Gemstones Just For You.
Mineral Creative - Web Brand Print
Welcome to Mineral Creative. WE CREATE TOTALLY AWESOME WEBSITES and BRANDING. Websites from 299 inc. basic logo design. We are a design and web consultancy specialising in branding, websites, copywriting and graphic design. From start up businesses to established brands - we can help. Websites which can be completly manageable by you, the client. Responsive, mobile websites. We build sites for mobile, tablet and desktop - no extra fees. Design and web packages. Take a look at our recent projects. We coul...
Mineral Creek Essentials - Made in Alaska Handcrafted Artisan Soaps
Site last updated 09/11/2012. Handmade Artisan Soaps at wonderful prices, pure silky sudsy bliss is well worth it, so even if you don't order from us, find a soap maker near you and see what a great experience it is! Your skin will be able to tell the difference. and love you for it! 100% Handmade in Alaska. I've have made the decision to shut down the online store, sorry for any inconvenience it has caused, and thank you for the business over the last few years. We have something for everyone!
mineralcreektherapyanimals.weebly.com
Mineral Creek Therapy Animals - Home
Mineral Creek Therapy Animals. Pino, miniature donkey. Mineral Creek's therapy donkeys and dogs are Delta Society registered Pet Partner Teams. Elin Phillips, owner and handler, is a member and instructor for the Delta Society and a member of R.E.A.D. Create a free website.
ERRP | Expired Registration Recovery Policy
Expired Registration Recovery Policy. This domain name registration has expired and renewal or deletion are pending. If you are the registrant and want to renew the domain name, please contact your registration service provider. Diese Domainregistrierung ist abgelaufen und die Verlängerung oder Löschung der Domain stehen an. Wenn Sie der Registrant sind und die Domainregistrierung verlängern möchten, kontaktieren Sie bitte Ihren Service-Provider. Por favor, tenga en cuenta:.
