mitchpentagon.blogspot.com
First with the NewsFormer Pentagon Correspondent at The Times, Michael Evans and now author of First with the News memoir, gives his weekly view of this crazy world.
http://mitchpentagon.blogspot.com/
Former Pentagon Correspondent at The Times, Michael Evans and now author of First with the News memoir, gives his weekly view of this crazy world.
http://mitchpentagon.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
0.7 seconds
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
0
SITE IP
172.217.3.97
LOAD TIME
0.656 sec
SCORE
6.2
First with the News | mitchpentagon.blogspot.com Reviews
https://mitchpentagon.blogspot.com
Former Pentagon Correspondent at The Times, Michael Evans and now author of First with the News memoir, gives his weekly view of this crazy world.
mitchpentagon.blogspot.com
mitch at the pentagon: November 2012
http://mitchpentagon.blogspot.com/2012_11_01_archive.html
Mitch at the pentagon. Saturday, November 3, 2012. It's cotton pickin politics. Get it yourself, Mr President! This Benghazi affair, who’s to blame? Not you Mr President), Am I going to win reelection? Of course, Mr President, we’ve fixed Ohio good). Well done, guys, off you go, my directive is, get me and Sandy together as much as possible, I am the Commander-in-Chief after all (Yessir! It won’t happen. Remember, Obama’s mates have fixed Ohio good. The US of A is obsessed with elections. They never ...
mitch at the pentagon: January 2012
http://mitchpentagon.blogspot.com/2012_01_01_archive.html
Mitch at the pentagon. Sunday, January 29, 2012. Shoot first, no questions afterwards. I was sitting at the back of a room packed with about 100 journalists. All the questions were blaa blaa blaa and the answers were blaa blaa blaa. It was falling asleep time. I popped up my hand and caught the eye of the Assistant Defence Secretary (public affairs), and to my astonishment, he said: "This is the last question. Mike? Subscribe to: Posts (Atom). Shoot first, no questions afterwards. View my complete profile.
mitch at the pentagon: A changing America
http://mitchpentagon.blogspot.com/2012/09/a-changing-america.html
Mitch at the pentagon. Tuesday, September 18, 2012. Dave is now a tree-feller and has already lost a finger! Yes, a typical middle class American couple, fearful of the future for themselves and for their six kids. This is America today. Schott En El Blog. September 26, 2012 at 3:59 AM. Deep America just around every corner! Subscribe to: Post Comments (Atom). View my complete profile. Picture Window template. Powered by Blogger.
mitch at the pentagon: It's cotton pickin politics
http://mitchpentagon.blogspot.com/2012/11/its-cotton-pickin-politics.html
Mitch at the pentagon. Saturday, November 3, 2012. It's cotton pickin politics. Get it yourself, Mr President! This Benghazi affair, who’s to blame? Not you Mr President), Am I going to win reelection? Of course, Mr President, we’ve fixed Ohio good). Well done, guys, off you go, my directive is, get me and Sandy together as much as possible, I am the Commander-in-Chief after all (Yessir! It won’t happen. Remember, Obama’s mates have fixed Ohio good. The US of A is obsessed with elections. They never ...
mitch at the pentagon: Last post
http://mitchpentagon.blogspot.com/2013/02/last-post.html
Mitch at the pentagon. Tuesday, February 26, 2013. Things I'll miss: passing conversations, like the other day I heard two blokes coming up the escalator behind me, one saying to the other: "We gotta push the agency's mission to the limit." Other bloke: "And beyond." First bloke: "Uhun! Enough already. Time to sign off. Time to go home to Blighty. Time to say goodbye to the US of A. It's been a ball. See yer. Subscribe to: Post Comments (Atom). View my complete profile.
TOTAL PAGES IN THIS WEBSITE
19
Mitch Peake | Programmer
Hi, I'm Mitch and I like making fun things! I am currently studying Computer Science for Games at Sheffield Hallam University. I currently focus on Web Development and 2D Gaming. Outside of studying, I enjoy gaming, record collecting, fitness and sports. Please feel free to look at my portfolio. Here is a sneak preview on what I've been working on.
Mitch Peasley & the Thundering Ukuleles | Mitch Peasley Thundering Ukuleles
MVP Wine
Mitch Pender on Twitter. Blog at WordPress.com. The Hemingway Rewritten Theme. Follow “MVP Wine”. Get every new post delivered to your Inbox. Build a website with WordPress.com.
The Naked Observer | One person's view of the world around us
One person's view of the world around us. Remember when Montreal wasn’t ONLY French? January 7, 2012. Watching the recent controversy around the hiring of a unilingual coach in Montreal is really really annoying me. True, the Montreal Canadiens have a large French speaking fan base, and it seems logical that the coach would benefit from speaking French (to the fans). What is driving me nuts however is the complete misrepresentation of the history of the Canadiens and indeed Montreal. October 16, 2011.
This Web site coming soon
If you are the owner of this web site you have not uploaded (or incorrectly uploaded) your web site. For information on uploading your web site using FTP client software or web design software, click here for FTP Upload Information.
First with the News
First with the News. Former Pentagon Correspondent at The Times, Michael Evans and now author of First with the News memoir, gives his weekly view of this crazy world. Tuesday, February 26, 2013. Things I'll miss: passing conversations, like the other day I heard two blokes coming up the escalator behind me, one saying to the other: "We gotta push the agency's mission to the limit." Other bloke: "And beyond." First bloke: "Uhun! Saturday, January 26, 2013. One official: "So, what's happening? Sitting at ...
Mitch Pentecost
Welcome to mitchpentecost.info. Powered by InstantPage® from GoDaddy.com. Want one?
Home | Mitch Perez
916) 505-8828 mperez@fnf.com. Instant CFPB Timeline Calculator. All About the CFPB. About Title and Escrow. About Escrow and Closing. CA Fast Fact Library. Buyer and Seller Guide. With origins that can be traced back 150 years, Fidelity National Title. Through its underwriting subsidiaries, is one of the nation's premier real estate service companies, providing title insurance and other real estate-related products and services. Highest Standard of Conduct. Western Title Insurance Company (now Fidelity N...
mitchperlissfitnessdvdmarketing.com
Home
Error Page cannot be displayed. Please contact your service provider for more details. (26).
mitchperrins.com
Mitch honed his skills in New York City over the course of ten years. During that time he performed with some of the biggest names in jazz at legendary venues such as Smalls, Iridium, Blue Note and the Gene Harris Jazz Festival. The CD release ‘Keeping Up Appearances’ received a stellar review from AAJ Magazine and Mitch is now seeking UK venues to premiere his new work ‘The Survival Suite’. The Mitch Perrins Atlantic Quartet. Checkout more of my music recorded at top NYC venues.
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - cheap web hosting - Frontpage Hosting E-Commerce Web Hosting Bluehost
Web Hosting - courtesy of www.bluehost.com.
