Cocktail company offering a selection of cocktail-based services including mobile cocktail bar hires, cocktail making classes and a shop for Mixology products.
http://mixologyevents.co.uk/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
1.7 seconds
16x16
32x32
64x64
128x128
160x160
192x192
PAGES IN
THIS WEBSITE
17
SSL
EXTERNAL LINKS
7
SITE IP
176.58.116.85
LOAD TIME
1.656 sec
SCORE
6.2
Cocktail Making Classes & Cocktail Bar Hire London | mixologyevents.co.uk Reviews
https://mixologyevents.co.uk
Cocktail company offering a selection of cocktail-based services including mobile cocktail bar hires, cocktail making classes and a shop for Mixology products.
mixologyevents.co.uk
Mixology Events – Private & Corporate Cocktail Events London
https://mixologyevents.co.uk/locations
Mixology Studios is our permanent cocktail masterclass lounge and is located in the vibrant area of Shoreditch, east London. Mixology can host events at partnership venues throughout London. We also provide a mobile cocktail bar hire service that allows us to provide our private cocktail classes and cocktail bar hire services at any location in the country. Or call 02031 312 706. Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. Who we have worked with recently:. Step 1 of 2.
Bar School and Mixologist Training / Cocktail Making
https://mixologyevents.co.uk/cocktail-training
Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. This field is for validation purposes and should be left unchanged. Mixology Events Bar School and Mixologist Training is hosted in our purpose custom built cocktail workshop in Shoreditch, London. The bar and cocktail training benefits from high level interaction based learning which is possible due to the cocktail workshop format. Mixology Studios, Shoreditch. We can also come to you, we operate nationally. Get practical t...
Mailing List | Mixology Events
https://mixologyevents.co.uk/join-the-mailing-list
Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. This field is for validation purposes and should be left unchanged. Join the Mixology Events Mailing List. Find out about all the latest Mixology news and offers first by subscribing to our mailing list. We will not spam you or share your details with any. Third parties. It’s also easy to unsubscribe at any time if you wish. This field is for validation purposes and should be left unchanged. Who we have worked with recently:.
Feedback on your experience with Mixology Events
https://mixologyevents.co.uk/feedback
Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. This field is for validation purposes and should be left unchanged. Here at Mixology Events we are always trying to improve our service. We find a brilliant way to help us do this is to get feedback from individuals like yourself who have taken part in a Masterclass or sipped one of our cocktails made for you! We are Releasing a You tube and how to website very shortly! Thanks for your time and hopefully your feedback!
Portfolio | Mixology Events
https://mixologyevents.co.uk/portfolio
Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. This field is for validation purposes and should be left unchanged. Who we have worked with recently:. Call us now on 02031 312 706. Or use the form below:. Step 1 of 2. Full Name. *. This field is for validation purposes and should be left unchanged. Telephone 02031 312 706. 17B Kingsland Road, London E2 8AA. All content Mixology Events 2015 Website design and development by Associatethis - Oxford.
TOTAL PAGES IN THIS WEBSITE
17
ashleywakefieldwhtyeandmackay.blogspot.com
Ashley Wakefield Whtye and Mackay Brief: March 2011
http://ashleywakefieldwhtyeandmackay.blogspot.com/2011_03_01_archive.html
Ashley Wakefield Whtye and Mackay Brief. Sunday, 20 March 2011. A good reference link about mixing cocktails. This may help if I decide to promote Glayva via an event of some kind. Http:/ cocktails.about.com/od/mixology/Mixology The Art of Mixing Cocktails.htm. Here is a good web link to a cocktail company offering a wide selection of services based around the highest standard of, up to date, innovative cocktails. Http:/ www.mixologyevents.co.uk/. Salmon like the fish. Presented by EFFEN Vodka. As mixolo...
Wedding Diary - Dom & Jay
http://www.domandjay.com/wedding-diary
13, August 2016. By Dom and Jay. Well; what can we say except a massive thank you to everyone who came to our wedding on Friday. To say we were totally overwhelmed by the love in the room would be a total understatement! We loved the whole day and judging by the comments from all of you, so did you. As you know we are now about to board a plane to whisk us off on our honeymoon but we wanted to share with you the pictures which were taken in the Photobooth. Or to print them out and throw darts at them.
Upcoming Events | Cocktailheure
https://cocktailheure.wordpress.com/upcoming-events-cocktailheure
Signature cocktails in London and around the world! 8211; The bar with no name brings you:. Tequila and Mezcal Cocktails Masterclass. On S aturday 23rd June, 2012. Experience the distinct flavours from south of the border in the inimitable bar with no name fashion. More information and bookings. London Cocktail Week 2012. The party at London’s Cocktail Week 2012. Starts on Monday 8th October and runs all the way through to Sunday 14th October. For pre-event enquiries contact:. Leave a Reply Cancel reply.
Dom and Jay, Author at Dom & Jay
http://www.domandjay.com/wedding-diary/author/dnjadmin
13, August 2016. By Dom and Jay. Well; what can we say except a massive thank you to everyone who came to our wedding on Friday. To say we were totally overwhelmed by the love in the room would be a total understatement! We loved the whole day and judging by the comments from all of you, so did you. As you know we are now about to board a plane to whisk us off on our honeymoon but we wanted to share with you the pictures which were taken in the Photobooth. Or to print them out and throw darts at them.
Hemmingway Bar – Ritz Paris | Cocktailheure
https://cocktailheure.wordpress.com/2012/06/17/hemingway-bar-ritz-paris
Signature cocktails in London and around the world! Hemmingway Bar – Ritz Paris. On June 17, 2012. Posted in: Cocktails in London. Tagged: Death in the afternoon. A few days ago I took a quick trip to Paris and was very excited to visit the Ritz Hotel. And more specific, the Hemmingway Bar! The bar has a very unique story…. Death In The Afternoon – Bar Hemingway. Apparently in 1944, Ernest Hemmingway. In addition to single malt Scotch and daiquiris (the real ones, not it’s fruity counterpart served...
New Fashioned… | Cocktailheure
https://cocktailheure.wordpress.com/2012/06/17/new-fashioned
Signature cocktails in London and around the world! On June 17, 2012. Posted in: Cocktails around the world. In a recent trip to the US I visited along with family one of my favourite restaurants in Chicago, Destihl. New Fashioned – Desthil. 2 oz blended bourbon. Serve in an old fashioned glass, add ice and stir. Serve with a swizzle stick. Share on Facebook (Opens in new window). Click to share on Twitter (Opens in new window). Click to share on LinkedIn (Opens in new window). Leave a Reply Cancel reply.
Taste of London 2012 – Encantador Cocktail | Cocktailheure
https://cocktailheure.wordpress.com/2012/06/23/taste-of-london-2012-encantador-cocktail-gaucho-restaurant-bar-boulud-savoy-grill-barbecoa-jamie-oliver-adam-perry-lang
Signature cocktails in London and around the world! Taste of London 2012 – Encantador Cocktail. On June 23, 2012. Posted in: Cocktails in London. Taste of London Festival. If you haven’t made to the Taste of London Festival yet, you are missing out! You have only two more days to experience it. I visited the Taste of London Thursday 21st and had a great time visting different restaurant tents. Among my favourites: ‘Basque’ spicy confit duck from Club Gascon. Skirt steak from Gaucho. Enter your comment he...
TOTAL LINKS TO THIS WEBSITE
7
Home
We specialize in Weddings, Middle and High School Dances, Corporate Events,. Company Parties / Picnics,. College Frat Parties and. Providing DJ Service in the Puget Sound Area and Beyond. Mixology Entertainment "We Mix The Right Music For You". Corporate and Private Events. School Dance Top 30. Select the date of your event. Then click on the "check availability" button to see if we are available on that date.
Mixology DJ Services | West Michigan DJ Services
Serving West MIchigan and Beyond! Welcome to Mixology DJ Services…. mixing music down to a science. Our DJ’s have over 20 years of combined experience in the entertainment industry. We strive to tailor each and every performance in to your dream event. Weddings, Corporate Events, Parties, School Dances, and more! Contact us today for prices, availability, and specials!
Bienvenidos a MIXOLOGY DRINKS
Bienvenidos a MIXOLOGY DRINKS. Estamos actualizando los contenidos de la Web. Esperamos de nuevo tu visita! Lorem ipsum dolor sit amet.
Mixology Entertainment
WELCOME TO MIXOLOGY ENTERTAINMENT. BRANDING / CONSULTING / LIFESTYLE MARKETING. OCTAVIEW #010 Mark Lewis. Mark Lewis Live 60min. November 30 2013 From Club Octagon. MARK LEWIS @ AVALON / TRANCE MISSION TOUR. Paul Oakenfold presents trance mission us tour. dj icon invites mark lewis to us tour dates to rock the edm fans on the west coast. the sound of cutting edge progressive tunes is the sound of the future…. MIXOLOGY BRAND SIZZLE & PRODUCT PLACEMENT REEL. Run To Party / 5k Marathon Los Angeles Fall 2015.
Cocktail Making Classes & Cocktail Bar Hire London
Cocktail Classes and Bar Hire. Mixology Events provide cocktail making classes and spirit tastings in house at Mixology Studios, our permanent home in the vibrant area of Shoreditch, east London. Mixology also offer cocktail events in partnership venues throughout London, as well as the option to take our mobile cocktail classes and mobile cocktail bar hire service to any area in the UK. Or call 02080 037 982. Call us now on 02080 037 982. Or use the form below:. Step 1 of 2. Full Name. *. We aim to brin...
mixologyfilms.com
This Site Is Under Construction and Coming Soon. This Domain Is Registered with Network Solutions.
Mixology Flair Camp - 2016
By ticking this box you are accepting that you are above the legal drinking age in your area. Click to proceed further.
mixologyflaird.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
Mixology Flaired
At Mixology Flaired we specialize in the art of beverage creation. No matter how many delicious cocktails we create, our insatiable hunger for exceptional libations is only growing. Hand crafted beverages have the power to challenge, excite, and transport us into a memory of the past. What distinguishes us is the way we combine ingredients and the authority to create cocktails while entertaining throughout your event. THERE IS NEVER A DULL MOMENT WHEN MIXOLOGY FLAIRED IS IN THE ROOM. As Seen At/ Clients:.
mixologyflared.com - Registered at Namecheap.com
This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! This domain is registered at Namecheap. This domain was recently registered at Namecheap. Please check back later! The Sponsored Listings displayed above are served automatically by a third party. Neither Parkingcrew nor the domain owner maintain any relationship with the advertisers.
