![mossleyhill.com](http://fav.cln.bz/ocol2mhmiyblktcpuvclnwjj/64/mossleyhill.com.png)
mossleyhill.com
Web Hosting, Reseller Hosting & Domain Names from Heart InternetReseller Hosting, Web Hosting, Dedicated Servers & Domain Names | Heart Internet
http://www.mossleyhill.com/
Reseller Hosting, Web Hosting, Dedicated Servers & Domain Names | Heart Internet
http://www.mossleyhill.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
1 seconds
Nick Waters
Nick Waters
PO ●●●X 5
Ne●●nt , Gloucestershire, GL18 1YG
GB
View this contact
Nick Waters
Nick Waters
PO ●●●X 5
Ne●●nt , Gloucestershire, GL18 1YG
GB
View this contact
Nick Waters
Nick Waters
PO ●●●X 5
Ne●●nt , Gloucestershire, GL18 1YG
GB
View this contact
20
YEARS
11
MONTHS
10
DAYS
MESH DIGITAL LIMITED
WHOIS : whois.meshdigital.com
REFERRED : http://www.meshdigital.com
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
0
SITE IP
79.170.40.4
LOAD TIME
1.031 sec
SCORE
6.2
Web Hosting, Reseller Hosting & Domain Names from Heart Internet | mossleyhill.com Reviews
https://mossleyhill.com
Reseller Hosting, Web Hosting, Dedicated Servers & Domain Names | Heart Internet
Mossley AFC
Home - Westholme Mossley Freemasons Hall
Venue and Private Hall. The Perfect Venue for the most Memorable Day of your Life. Christmas Bookings Now Being Taken at Westholme.
Mossley Garage | Auto Mechanic in Mossley
MOT & Servicing. We’re experts in all auto electrical works and provide a reliable and efficient auto electrician mobile service. We have great offers available on MOT's. If you have a classic car that is need of some engine tuning, mechanical repair or even some work on restoring the bodywork, get in touch. If you have been involved in an accident or suffered damage to your car, we have a body repair team that can bring your car back to looking brand new. Welcome to Mitchells Auto Centre. Millimetres, a...
Home Page
Welcome to the website of Mossley Hall; a grade 2 listed building in Mossley, Lancashire. To learn more about Mossley Hall and it's heritage visit the history page.
Mossley Post Heritage & Citizenship Society Website
Mossley Post Heritage and Citizenship Society. Welcome to the Mossley Post Heritage and Citizenship Society Website! Our mission is to provide Thames Centre residents with a cultural and social facility,. And to promote historical knowledge and an appreciation of our local heritage.". Mossley Post Heritage and Citizenship Society, Website by LaBute Management and Consulting.
Web Hosting, Reseller Hosting & Domain Names from Heart Internet
This domain has been registered by Heart Internet if you are the owner of this domain please login. Unlimited web hosting packed full of great hosting features, from only £2.49 per month. Find out more about our unlimited web hosting. Make money selling unlimited websites, domain names and more with our white label reseller hosting package. Great value domain names from only £2.79 per year. Already have a domain? Transfer in your domain for free. The UK's Best Reseller Package. Own Branded Control Panel.
Default Web Site Page
If you are the owner of this website, please contact your hosting provider: webmaster@mossleyhillathleticclub.com. It is possible you have reached this page because:. The IP address has changed. The IP address for this domain may have changed recently. Check your DNS settings to verify that the domain is set up correctly. It may take 8-24 hours for DNS changes to propagate. It may be possible to restore access to this site by following these instructions. For clearing your dns cache.
mossleyhillchildrenscentre.com
Home Page :: Garston Church & Mossley Hill Children's Centre, Liverpool, United Kingdom
This website places cookies on your computer ( more info. By continuing to use this website you are consenting to these cookies. Garston Church and Mossley Hill Children's Centre. Welcome to Church and Mossley Hill Childrens Centre Website, We hope you find your visit useful and enjoyable! Wed 12 Aug 2015. Download the latest Garston Church and Mossley Hill Children's Centre Newsletter. Website design for primary schools, by PrimarySite.net.
mossleyhillchimneysweepservice.com
Mossley Hill Chimney Sweep Service
Regular chimney cleaning is important. In order to prevent chimney fires and reduce the risk of dangerous fume emissions. At least once a year. At least twice a year. Quarterly when in use. At least once a year. At least twice a year. At least once a year. Welcome to Mossley Hill Chimney Sweep Service. My aim is to provide a professional, reliable, quality chimney sweep service, ensuring the highest standards for my customers.
Mossley Hill Church – Church
Mossley Hill Team Ministry - St Matthew and St James. Churches Together In Mossley Hill. Our Parish And Community. Marriage Preparation Course - A Space to Think. Mossley Hill - Linking Lives. Children And Young People. Holiday Club 2017: The Guardians of Ancora. CAMEO: a place to meet during the week. Colin Porter: Organist at Mossley Hill Parish Church. THE 1874 ‘FATHER’ WILLIS ORGAN. A warm welcome to. Mossley Hill Parish Church. Which is open and relevant to our times. Church Open Day Wednesday April .
mossleyhillpre | Just another WordPress.com site
On: March 9, 2011. Pre-School will be closed on 29th April. On: January 18, 2011. Welcome to WordPress.com. This is your first post. Edit or delete it and start blogging! Hi, this is a comment.To delete a comment, just log in, and view the posts' comments, there you will have the option to edit or delete them. Blog at WordPress.com. Create a free website or blog at WordPress.com.