adri-is-torres9.skyrock.com
Espace Pub - Fernando Torres Liverpool's Number Nine ;)
http://adri-is-torres9.skyrock.com/2001954619-Espace-Pub.html
Fernando Torres Liverpool's Number Nine ;). 04/08/2008 at 3:44 AM. 14/03/2010 at 8:44 AM. Soundtrack of My Life. In Too Deep (All Killer No Filler). Subscribe to my blog! Return to the blog of Adri-is-Torres9. Posted on Saturday, 06 September 2008 at 8:58 AM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.2) if someone makes a complaint. Please enter the sequence of characters in the field below.
an4a.skyrock.com
azgylt:lfgyretfgdjflmgpghbvnvnvnvkldldldfelfjduryduhfjkhlskhfilfhklfhldfhsqgfggfjdkdkdldldlddlgjkjgklfgklghfhfklgfklgjkl - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2081878037-azgylt.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. Add this video to my blog. Posted on Sunday, 19 October 2008 at 7:25 AM. Edited on Saturday, 22 November 2008 at 2:58 AM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.5) if someone makes a complaint. Monday, 26 October 2009 at 12:45 PM. Post to my ...
an4a.skyrock.com
fkzfdelgfemgfemcvdhcvhrieygfirpcvzdhicvidzpfoerycfdzhicvdyigfeizvczevicizyfzgamdfoagzcvzeifomzegfaeofgeimzgfm - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2051919869-fkzfdelgfemgfemcvdhcvhrieygfirpcvzdhicvidzpfoerycfdzhicvdyigfeizvczevi.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. She eyes me like a pisces when I am weak. I've been locked inside your Heart-Shaped box for weeks. I've been drawn into your magnet tar pit trap. I wish I could eat your cancer when you turn black. I've got a new complaint. Forever in debt to your priceless advice. I've got a new complaint. Forever in debt to your priceless advice. Jai rien piger lol.
an4a.skyrock.com
an4a's blog - Anaiiiis Anaiiiis - Skyrock.com
http://an4a.skyrock.com/1.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Ffftffzykitsdifts;liftqlsfdqfdfqffdfdfsfft;sqftqsf;gfqsgfthsgfhsgftfygfxhb;bmkpoiikjuytfrdezsaqsdfghjjkjjhygtgfffffhdjdjeuejdvv. Add this video to my blog. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.5) if someone makes a complaint. I need an easy friend. Don't forget that i...
an4a.skyrock.com
ffftffzykitsdifts;liftqlsfdqfdfqffdfdfsfft;sqftqsf;gfqsgfthsgfhsgftfygfxhb;bmkpoiikjuytfrdezsaqsdfghjjkjjhygtgfffffhdjdjeuejdvv - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2145160407-ffftffzykitsdifts-liftqlsfdqfdfqffdfdfsfft-sqftqsf.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. Ffftffzykitsdifts;liftqlsfdqfdfqffdfdfsfft;sqftqsf;gfqsgfthsgfhsgftfygfxhb;bmkpoiikjuytfrdezsaqsdfghjjkjjhygtgfffffhdjdjeuejdvv. Add this video to my blog. Posted on Tuesday, 18 November 2008 at 12:00 PM. Edited on Sunday, 21 December 2008 at 8:18 AM. Please enter the sequence of characters in the field below. Saturday, 06 December 2008 at 2:21 PM.
x-lovedet4a.skyrock.com
la vie ses koi.... - x-m4a avec mes toFFs
http://x-lovedet4a.skyrock.com/2165165917-la-vie-ses-koi.html
X-m4a avec mes toFFs. Prenom:melissa nom:gilabert surnom:email,m3li. age:13ans fume:non drogue:non. Humour:oui j'en est beaucoup. 13/07/2008 at 4:38 AM. 23/12/2008 at 1:21 PM. La vie ses koi. Subscribe to my blog! Return to the blog of x-lovedet4a. La vie ses koi. La vie est une chose extra ordinaire il ya beaucoup de surprises mais beacoup de choses. Dont ont est le centre par exemple sont travaille c'est nous qui le chosissont et pas les autres. Chaque moment de la vie. Post to my blog.
emo-boudeuz.skyrock.com
:) - DEATH __ †
http://emo-boudeuz.skyrock.com/2309563065-posted-on-2009-02-16.html
02/03/2008 at 5:17 AM. 26/09/2011 at 10:16 AM. Soundtrack of My Life. Never Think - Robert Pattinson (Twilight OST). I'm Here :) . Subscribe to my blog! Return to the blog of EmO-BouDeuZ. Posted on Monday, 16 February 2009 at 6:54 AM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.5) if someone makes a complaint. Please enter the sequence of characters in the field below. Je t'attend inh =).
yasmiina-ziik-skeii.skyrock.com
Yasmiina / Ma plume eternelle ( C-Sheyn ) (2009) - yasmiina-ziik-skeii
http://yasmiina-ziik-skeii.skyrock.com/2380198689-Yasmiina-Ma-plume-eternelle-C-Sheyn-2009.html
Blog perso= Poup4-kl3in.skyblog.com rajoute dans tes favoris ; ). 28/03/2009 at 4:35 AM. 31/03/2009 at 2:18 PM. Subscribe to my blog! Return to the Music Blog of yasmiina-ziik-skeii. Yasmiina / Ma plume eternelle ( C-Sheyn ) (2009). Listen to this track. Add this track to my blog. Ma plume eternelle ( C-Sheyn ). Posted on Saturday, 28 March 2009 at 1:12 PM. Edited on Tuesday, 31 March 2009 at 2:21 PM. Please enter the sequence of characters in the field below. Saturday, 25 April 2009 at 12:29 PM.
leona89.skyrock.com
Posted on Wednesday, 24 September 2008 at 4:48 AM - vla mes ami ma famille
http://leona89.skyrock.com/2034935607-posted-on-2008-09-24.html
Vla mes ami ma famille. 12/03/2008 at 8:11 AM. 23/06/2009 at 6:16 AM. Nouvelle vie. nouveau blog. Subscribe to my blog! Return to the blog of leona89. Posted on Wednesday, 24 September 2008 at 4:48 AM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.2) if someone makes a complaint. Please enter the sequence of characters in the field below. Thursday, 01 January 2009 at 1:24 AM. Petit test Triches pas!
willelmson.skyrock.com
willelmson's blog - Le sky de Rom - Skyrock.com
http://willelmson.skyrock.com/1.html
Le sky de Rom. 05/02/2006 at 7:08 AM. 22/08/2009 at 12:54 PM. Subscribe to my blog! CA C EST UN CLUB! Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.2) if someone makes a complaint. Please enter the sequence of characters in the field below. Posted on Friday, 24 October 2008 at 9:11 AM. Please enter the sequence of characters in the field below. Posted on Friday, 24 October 2008 at 9:10 AM. ET OUI IL ...