MUSE-ZIC-X.SKYROCK.COM
Music Blog of muse-zic-x - Muse (muse-zic-x) - Skyrock.comMusic Blog of muse-zic-x
http://muse-zic-x.skyrock.com/
Music Blog of muse-zic-x
http://muse-zic-x.skyrock.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
0.8 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
8
SSL
EXTERNAL LINKS
237
SITE IP
91.203.187.104
LOAD TIME
0.75 sec
SCORE
6.2
Music Blog of muse-zic-x - Muse (muse-zic-x) - Skyrock.com | muse-zic-x.skyrock.com Reviews
https://muse-zic-x.skyrock.com
Music Blog of muse-zic-x
muse-zic-x.skyrock.com
Origin of Symmetry / Plug In Baby (2001) - Muse (muse-zic-x)
http://muse-zic-x.skyrock.com/2073807281-Origin-of-Symmetry-Plug-In-Baby-2001.html
14/10/2008 at 12:06 PM. 25/03/2010 at 9:31 AM. Subscribe to my blog! Return to the Music Blog of muse-zic-x. Origin of Symmetry / Plug In Baby (2001). Listen to this track. Add this track to my blog. I've exposed your lies, baby. The underneath is no big surprise. Now it's time for changing. To forget your love. My plug in baby. When I'm tired of giving. My plug in baby. In unbroken virgin realities. Is tired of living. Baby you're gonna lose your own game. Change me, replace the envying. My plug in baby.
Music Blog of muse-zic-x - Page 2 - Muse (muse-zic-x) - Skyrock.com
http://muse-zic-x.skyrock.com/2.html
14/10/2008 at 12:06 PM. 25/03/2010 at 9:31 AM. Subscribe to my blog! Add to my blog. Add to my blog. Add to my blog. Add to my blog. Add to my blog. Time Is Running Out. Add to my blog. Add to my blog. Absolution / Time Is Running Out (2004). Listen to this track. Add this track to my blog. Time Is Running Out. I think I'm drowning. I wanna break this spell. I wanna play the game. I want the friction. You will be the death of me. Yeah, you will be the death of me. I won't let you bury it. Posted on Thurs...
The Resistance / Unnatural Selection (2009) - Muse (muse-zic-x)
http://muse-zic-x.skyrock.com/2650474910-The-Resistance-Unnatural-Selection-2009.html
14/10/2008 at 12:06 PM. 25/03/2010 at 9:31 AM. Subscribe to my blog! Return to the Music Blog of muse-zic-x. The Resistance / Unnatural Selection (2009). Listen to this track. Add this track to my blog. They'll laugh as they watch us fall. The lucky don't care at all. No chance for fate. I want the truth. I am hungry for some unrest. I want to push this beyond a peaceful protest. I wanna speak in a language that they'll understand. Dedication, to a new age. Is this the end of destruction and rampage?
Absolution / Time Is Running Out (2004) - Muse (muse-zic-x)
http://muse-zic-x.skyrock.com/2804631725-Absolution-Time-Is-Running-Out-2004.html
14/10/2008 at 12:06 PM. 25/03/2010 at 9:31 AM. Subscribe to my blog! Return to the Music Blog of muse-zic-x. Absolution / Time Is Running Out (2004). Listen to this track. Add this track to my blog. Time Is Running Out. I think I'm drowning. I wanna break this spell. I wanna play the game. I want the friction. You will be the death of me. Yeah, you will be the death of me. I won't let you bury it. I won't let you smother it. I won't let you murder it. Our time is running out. Our time is running out.
Music Blog of muse-zic-x - Muse (muse-zic-x) - Skyrock.com
http://muse-zic-x.skyrock.com/1.html
14/10/2008 at 12:06 PM. 25/03/2010 at 9:31 AM. Subscribe to my blog! Add to my blog. Add to my blog. Add to my blog. Add to my blog. Add to my blog. Time Is Running Out. Add to my blog. Add to my blog. Hysteria (MAXI) / Eternally Missed (2008). Listen to this track. Add this track to my blog. Chase your dreams away. Glass needles in the hay. The sun forgives the clouds. You are my holy shroud. I just don´t care if it´s real. That won´t change how it feels. I just don´t care if it´s real. I've exposed you...
TOTAL PAGES IN THIS WEBSITE
8
Mes citations du Mardi 13 Octobre - Blog de wingandwind
http://wingandwind.skyrock.com/2656486728-Mes-citations-du-Mardi-13-Octobre.html
Ce blog présente en gros tout ce que j'aime (et que vous aussi peut être). Son titre (wing and wind) veut dire aile et vent, il porte en lui également : win la victoire, wince faire la grimace, winry (Rockbell) en hommage à un manga que J'ADORE! Mais aussi à wink le clin d'oeil, winter l'hiver saison magnifique . C'est un titre libre, anormal (tant qu'a l'être soyons-le jusqu'au bout .) ainsi que magique. Bref bienvenue dans mon monde! 12/10/2009 at 9:22 AM. 01/06/2010 at 10:10 AM. Soundtrack of My Life.
Mwa ... :D - Blog de wingandwind
http://wingandwind.skyrock.com/2655557506-Mwa-D.html
Ce blog présente en gros tout ce que j'aime (et que vous aussi peut être). Son titre (wing and wind) veut dire aile et vent, il porte en lui également : win la victoire, wince faire la grimace, winry (Rockbell) en hommage à un manga que J'ADORE! Mais aussi à wink le clin d'oeil, winter l'hiver saison magnifique . C'est un titre libre, anormal (tant qu'a l'être soyons-le jusqu'au bout .) ainsi que magique. Bref bienvenue dans mon monde! 12/10/2009 at 9:22 AM. 01/06/2010 at 10:10 AM. Soundtrack of My Life.
Mon rap: La pluie ... - Blog de wingandwind
http://wingandwind.skyrock.com/2872962492-Mon-rap-La-pluie.html
Ce blog présente en gros tout ce que j'aime (et que vous aussi peut être). Son titre (wing and wind) veut dire aile et vent, il porte en lui également : win la victoire, wince faire la grimace, winry (Rockbell) en hommage à un manga que J'ADORE! Mais aussi à wink le clin d'oeil, winter l'hiver saison magnifique . C'est un titre libre, anormal (tant qu'a l'être soyons-le jusqu'au bout .) ainsi que magique. Bref bienvenue dans mon monde! 12/10/2009 at 9:22 AM. 01/06/2010 at 10:10 AM. Soundtrack of My Life.
wingandwind's blog - Page 4 - Blog de wingandwind - Skyrock.com
http://wingandwind.skyrock.com/4.html
Ce blog présente en gros tout ce que j'aime (et que vous aussi peut être). Son titre (wing and wind) veut dire aile et vent, il porte en lui également : win la victoire, wince faire la grimace, winry (Rockbell) en hommage à un manga que J'ADORE! Mais aussi à wink le clin d'oeil, winter l'hiver saison magnifique . C'est un titre libre, anormal (tant qu'a l'être soyons-le jusqu'au bout .) ainsi que magique. Bref bienvenue dans mon monde! 12/10/2009 at 9:22 AM. 01/06/2010 at 10:10 AM. Soundtrack of My Life.
miss-cullen-gwada's blog - Page 2 - Blog de miss-cullen-gwada - Skyrock.com
http://miss-cullen-gwada.skyrock.com/2.html
19/12/2009 at 12:10 PM. 25/08/2012 at 7:06 AM. Green Day - 21 Guns (Official Video). Subscribe to my blog! Joyeux noël tt le monde! Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.3) if someone makes a complaint. Please enter the sequence of characters in the field below. Posted on Monday, 21 December 2009 at 5:21 AM. Muse uprising official music clip video. Add this video to my blog. Vs aimé ou pas?
azgylt:lfgyretfgdjflmgpghbvnvnvnvkldldldfelfjduryduhfjkhlskhfilfhklfhldfhsqgfggfjdkdkdldldlddlgjkjgklfgklghfhfklgfklgjkl - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2081878037-azgylt.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. Add this video to my blog. Posted on Sunday, 19 October 2008 at 7:25 AM. Edited on Saturday, 22 November 2008 at 2:58 AM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.5) if someone makes a complaint. Monday, 26 October 2009 at 12:45 PM. Post to my ...
miss-cullen-gwada's blog - Page 6 - Blog de miss-cullen-gwada - Skyrock.com
http://miss-cullen-gwada.skyrock.com/6.html
19/12/2009 at 12:10 PM. 25/08/2012 at 7:06 AM. Green Day - 21 Guns (Official Video). Subscribe to my blog! Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.3) if someone makes a complaint. Please enter the sequence of characters in the field below. Posted on Saturday, 05 June 2010 at 5:09 AM. Green Day - 21 Guns (Official Video). Please enter the sequence of characters in the field below. Page 1 of 6.
fkzfdelgfemgfemcvdhcvhrieygfirpcvzdhicvidzpfoerycfdzhicvdyigfeizvczevicizyfzgamdfoagzcvzeifomzegfaeofgeimzgfm - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2051919869-fkzfdelgfemgfemcvdhcvhrieygfirpcvzdhicvidzpfoerycfdzhicvdyigfeizvczevi.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. She eyes me like a pisces when I am weak. I've been locked inside your Heart-Shaped box for weeks. I've been drawn into your magnet tar pit trap. I wish I could eat your cancer when you turn black. I've got a new complaint. Forever in debt to your priceless advice. I've got a new complaint. Forever in debt to your priceless advice. Jai rien piger lol.
ffftffzykitsdifts;liftqlsfdqfdfqffdfdfsfft;sqftqsf;gfqsgfthsgfhsgftfygfxhb;bmkpoiikjuytfrdezsaqsdfghjjkjjhygtgfffffhdjdjeuejdvv - Anaiiiis Anaiiiis
http://an4a.skyrock.com/2145160407-ffftffzykitsdifts-liftqlsfdqfdfqffdfdfsfft-sqftqsf.html
04/04/2008 at 3:42 AM. 02/11/2009 at 2:18 PM. Soundtrack of My Life. Plug In Baby (Origin of Symmetry). Subscribe to my blog! Return to the blog of an4a. Ffftffzykitsdifts;liftqlsfdqfdfqffdfdfsfft;sqftqsf;gfqsgfthsgfhsgftfygfxhb;bmkpoiikjuytfrdezsaqsdfghjjkjjhygtgfffffhdjdjeuejdvv. Add this video to my blog. Posted on Tuesday, 18 November 2008 at 12:00 PM. Edited on Sunday, 21 December 2008 at 8:18 AM. Please enter the sequence of characters in the field below. Saturday, 06 December 2008 at 2:21 PM.
Green_Day_ - Blog de miss-cullen-gwada
http://miss-cullen-gwada.skyrock.com/2734642584-Green-Day.html
19/12/2009 at 12:10 PM. 25/08/2012 at 7:06 AM. Green Day - 21 Guns (Official Video). Subscribe to my blog! Return to the blog of miss-cullen-gwada. Posted on Thursday, 24 December 2009 at 12:27 PM. Edited on Thursday, 24 December 2009 at 12:37 PM. Don't forget that insults, racism, etc. are forbidden by Skyrock's 'General Terms of Use' and that you can be identified by your IP address (66.160.134.3) if someone makes a complaint. Please enter the sequence of characters in the field below. Post to my blog.
TOTAL LINKS TO THIS WEBSITE
237
Blog de Muse-yoshi - Blog de Muse-yoshi - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Bonjour,hola,hello à toutes et à tous.Bienvenues sur mon blog.Ici je posterais de la kpop.Et oui je suis une fan de kpop! J'adore sa,j'en écoute tout le temps :) J'espère que mon blog vous plaira et que vous passerez un très bon moment tout en le visitant :). Je ne serai pas beaucoup présente pendant les. Mise à jour :. Drama Coréen ♥. Royal Family. Gif animé ♥. Imagine Ilhoon et toi. Source image google image. Super Junior ❤. Tagué pour la 2eme fois. Nom rée...
Muse-Zach
Anthrax and In This Moment added to ROTR. Did the Cowboy rope a #1? ROTR Rumors: The Avalanche Tour. A Look at The Grateful Dead's Discography. Rock on The Range Lineup Release Date. Oh Whitney, if only Costner was still taking care of you. ROTR: Five Finger Death Punch and Theory of A Deadman. Which one you think is the middle finger? Rock on The Range: Godsmack, Staind, Halestorm. What does this tour say about ROTR? Rock on The Range: Red Hot Chili Peppers. 65279;50, 49, and 49. Rock Hall 2012 Inductees.
Blog de muse-zarbe-fic - Blog de muse-zarbe-fic - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Ici je vais mettre des fictions que j'inventerais avec ma petite tete de museuse! Comme vous l'aurez compris je vais ecrire des fics portant su nos chers Muse! Je suis une putain de psychopathe et ton cul. Mise à jour :. Abonne-toi à mon blog! Hello tout le monde! Comme le montre le nom de l'article, ci-dessous vous trouverez una presentation de me! Moi c'est Julia mais Juju pour les intimes! Je suis une grande Museuse et j'aime plus que tout la musique!
Default Parallels Plesk Panel Page
Web Server's Default Page. This page is generated by Parallels Plesk Panel. The leading hosting automation software. You see this page because there is no Web site at this address. You can do the following:. Create domains and set up Web hosting using Parallels Plesk Panel. Parallels is a worldwide leader in virtualization and automation software that optimizes computing for consumers, businesses, and Cloud services providers across all major hardware, operating systems, and virtualization platforms.
Music Blog of muse-zic-x - Muse (muse-zic-x) - Skyrock.com
14/10/2008 at 9:06 AM. 25/03/2010 at 6:31 AM. Subscribe to my blog! Add to my blog. Add to my blog. Add to my blog. Add to my blog. Add to my blog. Time Is Running Out. Add to my blog. Add to my blog. Hysteria (MAXI) / Eternally Missed (2008). Listen to this track. Add this track to my blog. Chase your dreams away. Glass needles in the hay. The sun forgives the clouds. You are my holy shroud. I just don´t care if it´s real. That won´t change how it feels. I just don´t care if it´s real. The underneath is...
Blog Music de muse-ziic - Love - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Libre comme le vent 3. Autre / Non spécifié. Mise à jour :. Abonne-toi à mon blog! Numéro de la piste. Ajouter à mon blog. Ajouter à mon blog. Ajouter à mon blog. Tu n'as pas la bonne version de Flash pour utiliser le player Skyrock Music. Clique ici pour installer Flash. Un blog parmis tant d'autre, mais celui là c'est le mien! Ou poster avec :. Retape dans le champ ci-dessous la suite de chiffres et de lettres qui apparaissent dans le cadre ci-contre. N'oub...
Blog Music de Muse-Ziick - Muse - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Mise à jour :. Undisclosed desires (2009) (2009). Abonne-toi à mon blog! Numéro de la piste. Ajouter à mon blog. Ajouter à mon blog. 9829;•Exo-Politics•♥. Ajouter à mon blog. Ajouter à mon blog. Ajouter à mon blog. Tu n'as pas la bonne version de Flash pour utiliser le player Skyrock Music. Clique ici pour installer Flash. Undisclosed desires (2009) (2009). Ajouter ce morceau à mon blog. Ou poster avec :. Posté le mercredi 30 décembre 2009 13:03. Hold you in ...
Blog de MuSe-ZiK-31 - *RoCk 4 3V3R* - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. En silence je t aime,. En secret je t adore. Si un jour je meurt. Et que tu ouvre mon coeur. Il sera ecrit en lettre d'or. L) je t'aime encore (L). Heureux je suis, quand avec moi tu es là. Loin de ton coeur, triste je suis. Prisonnier de toi, le coeur pris. L'âme, le corps, au paradis. Naturellement tu es pour mon coeur. La raison de tous ses battements. Tout mon amour est, de toi, pour toi. Très jeune et dejà amoureux. Mise à jour :. Abonne-toi à mon blog!
Blog Music de MuSe-ZiK-31bis - Muse - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Mise à jour :. Haarp / Hystéria (live) (2008). It's bugging me, grating me And twisting. Haarp / Plug In Baby (live) (2008). I've exposed your lies, baby The. Abonne-toi à mon blog! Plug In Baby (live). Numéro de la piste. Ajouter à mon blog. Plug In Baby (live). Ajouter à mon blog. Ajouter à mon blog. Tu n'as pas la bonne version de Flash pour utiliser le player Skyrock Music. Clique ici pour installer Flash. Haarp / Hystéria (live) (200 8). I want it now.
