Independent Living, Inc. is a consumer-directed, cross-disability advocacy and service organization dedicated to enhancing the quality of life for individuals
http://www.myindependentliving.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
1.8 seconds
16x16
32x32
64x64
128x128
160x160
192x192
LocalWire, Ltd.
LocalWire, Ltd.
Independ●●●●●●●●ng, Inc.
New●●●rgh , NY, 12550
US
View this contact
Independent Living, Inc.
Douglas Hovey
5 Washi●●●●●●●Terrace
New●●●rgh , NY, 12550
US
View this contact
Network Solutions, LLC.
Network Solutions, LLC.
13200 Wo●●●●●●●●rk Drive
He●●on , VA, 20171-3025
US
View this contact
BUY YOUR DOMAIN
Network Solutions, LLC (R63-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
3
SSL
EXTERNAL LINKS
40
SITE IP
74.220.219.189
LOAD TIME
1.844 sec
SCORE
6.2
Independent Living / Services for individuals with disabilities / Newburgh, Middletown, Monticello, NY | myindependentliving.org Reviews
https://myindependentliving.org
Independent Living, Inc. is a consumer-directed, cross-disability advocacy and service organization dedicated to enhancing the quality of life for individuals
SonicWall - Authentication
myindependentliving.org
Services – Independent Living
http://myindependentliving.org/EN-Services/Services
Governance & Sustainability. Consumer Direct Personal Assistance Services. Deaf & Hard-of-Hearing Services. Early Childhood Direction Center. Early Childhood Direction Center (Spanish). Supported and Supportive Housing. Links & Disclaimer. Offering consultative and supportive services aimed at increasing independence for recipients of SSDI and/or SSI benefits throughout the Hudson Valley by providing information and education on available work incentives. Deaf and Hard-of-Hearing Services. Provides outre...
News – Independent Living
http://myindependentliving.org/EN-News/News
Governance & Sustainability. Consumer Direct Personal Assistance Services. Deaf & Hard-of-Hearing Services. Early Childhood Direction Center. Early Childhood Direction Center (Spanish). Supported and Supportive Housing. Links & Disclaimer. Independent Living in the News. To make sure you get our news and event announcements, please sign up for our newsletter here. We respect everyone's privacy and confidentiality; we won't give your information away. February 12, 2016. Click here to read the story. The G...
Supporters – Independent Living
http://myindependentliving.org/EN-News/Supporters
Governance & Sustainability. Consumer Direct Personal Assistance Services. Deaf & Hard-of-Hearing Services. Early Childhood Direction Center. Early Childhood Direction Center (Spanish). Supported and Supportive Housing. Links & Disclaimer. Friends of Independence Society Members. Luis and Beth Abarca *. Allan E. Atzrott *. Maureen Crush and Robert Whelan *. John and Kara Dorsey *. Richard and Patricia Hovey *. Hudson Valley Federal Credit Union. Hudson Valley Hospital Physicians. John and Anne Miller*.
TOTAL PAGES IN THIS WEBSITE
3
Additional Resources - Jewish Family Service
http://www.jfsorange.org/services/other-resources
Older Adults and Adults with Disabilities. Adults with Developmental Disabilities. Children in Need of Support. American Academy of Child and Adolescent Psychiatry. Autism Society of America. National Institutes of Health. NYS Office for Children and Families. NYS Coalition Against Domestic Violence. Safe Homes of Orange County. Office of Temporary and Disability Assistance. SUNY Orange Office of Careers and Internships. People for People Fund. Food Pantries and Soup Kitchens. Orange County Fuel Fund.
Qualifications: Criss Ittermann | Eclectic Tech
http://eclectictech.net/Info/Qualifications
Writing and Author Services. Writing and Author Services. Freelance Life/Business Coaching and Web Development. Various ( http:/ eclectictech.net. Beyond the Eighteenth, LLC website ( http:/ bte18.com/. Independent Living, Inc. ( http:/ myindependentliving.org/. Full-featured site for area non-profit organization. Behind-the-scenes coordinator for the annual QED Hudson Valley Business Edge conferences (2007-2010). August 2004-September 2005) [consulting through Digital Variant. Responsible for hardware a...
Safe Harbors of the Hudson | Event Space Rental - Safe Harbors of the Hudson
http://www.safe-harbors.org/event-space-rental
Event Space Rental - Safe Harbors of the Hudson. Transforming Lives and Building Community through Housing and the Arts. Contact & Directions. Transforming Lives and Building Community through Housing and the Arts. About the Cornerstone Residence. About the Ann Street Gallery. Contact and Gallery Hours. September 10, 2016. About The Lobby at the Ritz Theater. About The Historic Ritz Theater. Wolf Critton in Concert. September 24, 2016. SAFE HARBORS OF THE HUDSON. About Safe Harbors of the Hudson. The Ann...
Safe Harbors of the Hudson | Cart - Safe Harbors of the Hudson
http://www.safe-harbors.org/shop/cart
Cart - Safe Harbors of the Hudson. Transforming Lives and Building Community through Housing and the Arts. Contact & Directions. Transforming Lives and Building Community through Housing and the Arts. About the Cornerstone Residence. About the Ann Street Gallery. Contact and Gallery Hours. September 10, 2016. About The Lobby at the Ritz Theater. About The Historic Ritz Theater. Wolf Critton in Concert. September 24, 2016. SAFE HARBORS OF THE HUDSON. About Safe Harbors of the Hudson. June 14, 2016.
Safe Harbors of the Hudson | About The Lobby at the Ritz Theater - Safe Harbors of the Hudson
http://www.safe-harbors.org/the-ritz-theater/the-lobby-at-the-ritz-theater
About The Lobby at the Ritz Theater - Safe Harbors of the Hudson. Transforming Lives and Building Community through Housing and the Arts. Contact & Directions. Transforming Lives and Building Community through Housing and the Arts. About the Cornerstone Residence. About the Ann Street Gallery. Contact and Gallery Hours. September 10, 2016. About The Lobby at the Ritz Theater. About The Historic Ritz Theater. Wolf Critton in Concert. September 24, 2016. SAFE HARBORS OF THE HUDSON. June 14, 2016. Join us f...
Safe Harbors of the Hudson | Upcoming Events - Safe Harbors of the Hudson
http://www.safe-harbors.org/safe-harbors/upcoming-events
Upcoming Events - Safe Harbors of the Hudson. Transforming Lives and Building Community through Housing and the Arts. Contact & Directions. Transforming Lives and Building Community through Housing and the Arts. About the Cornerstone Residence. About the Ann Street Gallery. Contact and Gallery Hours. September 10, 2016. About The Lobby at the Ritz Theater. About The Historic Ritz Theater. Wolf Critton in Concert. September 24, 2016. SAFE HARBORS OF THE HUDSON. About Safe Harbors of the Hudson. Guest Bart...
ILC Directory
http://www.nysilc.org/index.php/ilc-directory
Main content - accesskey 1. Main menu - accesskey 2. Side menu - accesskey 3. NYS Independent Living Council. Empowering New Yorkers with Disabilities. Council Meetings and Calendar. Full Council Meeting Audio and Minutes. IL Philosophy & History Tutorial. Laurel Lei Kelley, Executive Director. Capital District Center for Independence. 845 Central Avenue, South 3. Albany, NY 12206-1504. TEL (518) 459-6422 V and TTY. Website: http:/ www.cdciweb.com. Office of Disability Services. Schenectady, NY 12302-1503.
orangecountynyddconnection.com
Provider Network - Orange County NY DD Connection
http://www.orangecountynyddconnection.com/provider-network.html
Calendar, Events and Trainings. Coordinated In-Home Supports Project. Services, Eligibility and Access. Service Applications and Forms. Provider Agency and Community Links. Part Time Job Postings. Orange County Developmental Disabilities Provider Network. 15 Fortune Road West. Middletown, NY 10940 (888) 750-2266. CAPABILITIES/EPILEPSY SOCIETY OF SOUTHERN NEW YORK. 200 Midway Park Drive. Middletown, NY 10940 (845) 627-0627. CHEMLU DEVELOPMENTAL DISABILITIES CENTER. 2 Garfield Road, Suite 201. Newburgh, NY...
Safe Harbors of the Hudson | Ann Street Gallery - Safe Harbors of the Hudson
http://www.safe-harbors.org/ann-street-gallery
Ann Street Gallery - Safe Harbors of the Hudson. Transforming Lives and Building Community through Housing and the Arts. Contact & Directions. Transforming Lives and Building Community through Housing and the Arts. About the Cornerstone Residence. About the Ann Street Gallery. Contact and Gallery Hours. July 16, 2016-August 20, 2016. About The Lobby at the Ritz Theater. About The Historic Ritz Theater. Ralph Williams in Concert. July 9, 2016. SAFE HARBORS OF THE HUDSON. About Safe Harbors of the Hudson.
TOTAL LINKS TO THIS WEBSITE
40
Domain Names - Domain Name Registration & Free Domain Transfers - myindependentfilms.net Parked
Another successful domain registration by Domainmonster.com. To manage your domain services including Web and Email forwarding, full DNS management enter your online control panel. Domain Name Registration - FREE with every domain name:. Web Forwarding (No adverts! FREE Transfer to and away from us. Total online live Domain Management. Online Ownership and Account Management. Unlimited Email and Phone Support. Plus much much more. Domainmonster.com - Free Domain Transfer Services:.
myindependentfinancialadviser.com.au
myIFA | My Independent Financial Adviser | Independent financial advice
My Independent Financial Adviser. Shopping cart is empty. My IFA Free Membership. Please login to access this area. My Independent Financial Adviser. 1 All product commissions, incentives, product bonus payments. Are put into the clients bank account each month. We are paid by the client and. Therefore we work for the client. We are not owned by a product provider. So we are free to select our clients the best products and strategies that fit their financial position. Building an Investment Portfolio.
Indian Association of Independent Candidates IAIC
Indian Association of Independent Candidates IAIC. Indian Association of Independent Candidates. June 25, 2015. Welcome To Indian Association of Independent Candidates. GGOPINATHAN B.A., C.A.I.I.B., N.C.F.M. RETIRED VOLUNTARILY AS CHIEF MANAGER FROM SBI IN JUL 2008. 8221;CHAIRMAN’S CLUB AWARD” FROM SBI and GE CAPITAL (JV) IN 2002. 8221;PAR EXCELLENCE AWARD” FROM M/S.MOSS MEDIA and THE ARAKONAM TOWN HALL IN 2008. June 25, 2015. WHY NO POLITICAL PARTY CAN RELEASE INDIA FROM HER SHACKLES? With the above dat...
Myindependentlife
What You Should Know About the Ownership of The Tapestry Showflat? When you get your Executive the tapestry showflat. This entry was posted on February 14, 2018, in General. How Could You Look for and Watch Motion pictures Online. Watch videos totally free online! Proper, it’s correct! When you need to access the 123 movies. This entry was posted on January 27, 2018, in Entertainment. Approaches to find the supportive condominium. When staying at a Twin view. You additionally find that there are distinct...
Independent Living / Services for individuals with disabilities / Newburgh, Middletown, Monticello, NY
Governance & Sustainability. Consumer Direct Personal Assistance Services. Deaf & Hard-of-Hearing Services. Early Childhood Direction Center. Supported and Supportive Housing. Links & Disclaimer. Promoting Choice, Self-Determination and Total Participation. Integrity, Respect, Customer Focus. Independent Living, Inc. Our efforts are directed to individuals of all ages having any disability, as well as to families, businesses, agencies, and municipalities. We are committed to the universal elimination...
Independent Living Aids - Ship Free!
Independent Living Aids Ship Free! Come checkout our selection today of independent living aids now! We have a broad selection that will suit any needs! CompXP Compressor Nebulizer with Case and Rechargeable Power Sources. Olympus Digital Voice Recorder- 2GB by Olympus. Weather Alert Radio with S.amE. Local Alerts by Midland. E-bot ADV Portable Magnifier for iPad, Android Tablet, PC or Mac by HIMS. Original GoBible - Catholic Version by MaxiAids. Let's face it, everyone has an innate desire to live indep...
W.C. Bruckner Realty - I Work For My Clients Not A Franchise
You have been successfully signed up. This page will refresh momentarily. Are you a member? I Work For My Clients Not A Franchise. Revel in stunning suburban landscapes. Family-friendly properties that exude comfort. Expansive residences for growing families. Comfortable, convenient homes for all buyers. Gorgeous, tree-lined streets. Fontana On Geneva Lake. Lake In The Hills. 1480 Milwaukee (Private Ln) Avenue Libertyville Illinois 60048. Add Listing to Favorites. Add Listing to Favorites. Selling your h...
Restaurant Marketing for Local Restaurants : Independent Restaurant Marketing Association
Restaurant Marketing to Put More Butts in Seats and Drive Sales. Since our founding in 2009, the Independent Restaurant Marketing Association has been helping independent restaurants and small to medium-sized restaurant chains across the country increase sales, lower costs, and maximize their marketing dollars in a digital age. Restaurateurs trust and work with us because we provide sound recommendations in a straightforward, hype-free fashion at a reasonable cost, with no drama. See how well your website.
www.myindependentspace.com
This site is under construction. Why am I seeing this page? Are you the owner of this domain? How to replace this page. Try these searches related to www.myindependentspace.com:. My Independent House is for Sale. My Space a Place for Friends. My Space Com Myspace. Free my Space Layout. My Girly Space Layout. Web Site for my Space. My Space Glitter Graphic. My Space Hot Free Layout. My Space Music Code. Free my Space Background. My Space .com. My Space Music Video Code. Alabama Independent Insurance Agent.
Independent Study
I've never been good at names. I seem to accumulate variations on my given name every time I transition. Lets go with Kathrine and/or Maia for now. I am, among many things, a yogic philosoraptor, writer and aesthetic enthusiast. I like hippie shit, growing/cooking/eating food, challenging standard narratives, and learning how to be a better human- mind,body and soul. Welcome to my Independent Study. Get updates on my travels.
SOCIAL ENGAGEMENT