PENNSYLVANIAMANUFACTURERS.COM
Price Request - BuyDomainsBuy a domain and see how a premium domain can be the best investment. Your business starts here. Buy a domain today.
http://www.pennsylvaniamanufacturers.com/
Buy a domain and see how a premium domain can be the best investment. Your business starts here. Buy a domain today.
http://www.pennsylvaniamanufacturers.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Monday
LOAD TIME
RARENAMES, INC.
WEB REG
738 MAIN ●●●●●●●●●SUITE 389
WA●●AM , MA, 02451
US
View this contact
RARENAMES, INC.
WEB REG
738 MAIN ●●●●●●●●●SUITE 389
WA●●AM , MA, 02451
US
View this contact
RARENAMES, INC.
WEB REG
738 MAIN ●●●●●●●●●SUITE 389
WA●●AM , MA, 02451
US
View this contact
14
YEARS
5
MONTHS
18
DAYS
ENOM, INC.
WHOIS : whois.enom.com
REFERRED : http://www.enom.com
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
0
SITE IP
0.0.0.0
LOAD TIME
0 sec
SCORE
6.2
Price Request - BuyDomains | pennsylvaniamanufacturers.com Reviews
https://pennsylvaniamanufacturers.com
Buy a domain and see how a premium domain can be the best investment. Your business starts here. Buy a domain today.
pennsylvaniamalpracticelawyers.com
PennsylvaniaMalpracticeLawyers.com
PennsylvaniaMalpracticeLawyers.com is For Sale for $700!
pennsylvaniamaltesebreeders.com
Maltese Breeders - Pennsylvania Maltese Breeders
Open 7 days and evenings. Are you a Maltese breeder? Join our network today! From our family to yours. We place Maltese puppies in caring lifelong homes in Pennsylvania and across the US. All of the puppies available on this website are from our exclusive national network of the finest Maltese breeders and may not necessarily be located in Pennsylvania. Shipping is available. Open 7 days and evenings. To Speak with a Puppy Specialist. Dog Breeders, Pet Store. Need help finding your puppy?
pennsylvaniamaltipoobreeders.com
Maltipoo Breeders - Pennsylvania Maltipoo Breeders
Open 7 days and evenings. Are you a Maltipoo breeder? Join our network today! From our family to yours. We place Maltipoo puppies in caring lifelong homes in Pennsylvania and across the US. All of the puppies available on this website are from our exclusive national network of the finest Maltipoo breeders and may not necessarily be located in Pennsylvania. Shipping is available. Open 7 days and evenings. Here is a photo of my Lucy with me. You can see why I loved her.isn't she the cutest!
pennsylvaniamanicure.com
The domain pennsylvaniamanicure.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
pennsylvaniamanicures.com
The domain pennsylvaniamanicures.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
pennsylvaniamanufacturing.com
This domain has expired. Renew it now at Fabulous.com.
pennsylvaniamap.com - This website is for sale! - pennsylvaniamap Resources and Information.
pennsylvaniamaplesyrupfestival.com
Pennsylvania Maple Syrup Festivals and Producers
Pennsylvania Maple Syrup Festivals and Producers. Where History is Remembered". Tuesday, April 22, 2008. Make sure to visit the national festivals website at. Http:/ www.nationalmaplesyrupfestival.com. Or click the picture below. Subscribe to: Posts (Atom). Get a "Sneak Preview" of the National Maple Syrup Festivals 2010 Television Ad. Click above to Compete and Win Big$ $. We encourage you to support the local economy- Buy Local! Casbolm Maple and Honey. Northwest Pennsylvania Maple Syrup Association.
pennsylvaniamarcellusgaslawyer.net
pennsylvaniamarcellusgaslawyer.net
SOCIAL ENGAGEMENT