Just a recovering perfectionist learning to enjoy her day to day life
http://perfectlyimperfectdg.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.9 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
3
SITE IP
192.0.78.12
LOAD TIME
1.938 sec
SCORE
6.2
Perfectly-Imperfect Domestic Gal | Just a recovering perfectionist learning to enjoy her day to day life | perfectlyimperfectdg.wordpress.com Reviews
https://perfectlyimperfectdg.wordpress.com
Just a recovering perfectionist learning to enjoy her day to day life
perfectlyimperfectdg.wordpress.com
Spring Alliums | Perfectly-Imperfect Domestic Gal
https://perfectlyimperfectdg.wordpress.com/2013/04/20/spring-alliums
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. Laquo; TWD: Rustic Potato Loaves. April 20, 2013. When we picked it up, the folks at Fair Shares suggested it was either large onions or some sort of garlic. But when I started breaking them down for dinner tonight, they appeared to be baby leeks due to the thickness of their green leaves and the way the layers overlapped each other. Adapted from Stir-Frying to the Sky’s Edge. 1 bunch small ...
September | 2014 | Perfectly-Imperfect Domestic Gal
https://perfectlyimperfectdg.wordpress.com/2014/09
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. Archives for the month of: September, 2014. September 18, 2014. I love this video because you can see the absolute joy on Evie’s face at the end of the slide…she loves them! Enter your email address to subscribe to this blog and receive notifications of new posts by email. Join 9 other followers. Blog at WordPress.com. Back to the top.
Love our big helper | Perfectly-Imperfect Domestic Gal
https://perfectlyimperfectdg.wordpress.com/2014/10/02/love-our-big-helper
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. Love our big helper. October 2, 2014. She gets about half of them in the right spot…and keeps herself busy for a few minutes! Or leave a trackback: Trackback URL. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Join 9 other followers.
February | 2013 | Perfectly-Imperfect Domestic Gal
https://perfectlyimperfectdg.wordpress.com/2013/02
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. Archives for the month of: February, 2013. February 19, 2013. I almost didn’t make this one. It wasn’t for lack of wanting, but one of exhaustion, an exhaustion that only those of new parents know. Where the likelihood of a successful day relies upon which child you’ve seen during the night. Is it the one that can easily be soothed by feeding/changing? I love making syrups on the stove becau...
Joy | Perfectly-Imperfect Domestic Gal
https://perfectlyimperfectdg.wordpress.com/2014/09/18/joy
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. Laquo; Spring Alliums. Love our big helper. September 18, 2014. I love this video because you can see the absolute joy on Evie’s face at the end of the slide…she loves them! Or leave a trackback: Trackback URL. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). Notify me of new comments via email.
TOTAL PAGES IN THIS WEBSITE
19
Focaccio with Rosemary and Balsamic Salt | louisawalter
https://louisawalter.wordpress.com/2013/02/05/focaccio-with-rosemary-and-balsamic-salt
Just another WordPress.com site. Laquo; French Apple Tart. Focaccio with Rosemary and Balsamic Salt. Posted February 5, 2013 by louisawalter in Uncategorized. Several problems were encountered with this recipe and solutions are offered. Drink a lot of beer before dinner, the difference between 17 hours and 36 doesn’t much matter! I had to use all the rosemary leaves on the focaccio. This was a lot! Use balsamic salt with the rosemary as a topping. It stays on and is very good! Did we like it? Update 12 h...
Pizza with Onion Confit | theboycanbake
https://theboycanbake.wordpress.com/2013/01/08/pizza-with-onion-confit
Just another WordPress.com site. French Apple Tart →. Pizza with Onion Confit. January 8, 2013. I’ve owned Baking With Julia. At this point, I would normally direct recipe hounds to the blog of a fellow baker wherein the recipe might be found. This week, I’m hosting, so the recipe is found at the end of this post. The efforts of other TWD bakers can be found here. 8220;to coax flavor from the grain.”. For toppings, I kept with the Provencal theme, adding clumps of soft chevre, quartered oil-and-salt-cure...
Thai-Inspired Butternut Squash Soup | You're In My Kitchen
https://youreinmykitchen.com/2011/02/21/thai-inspired-butternut-squash-soup
You're In My Kitchen. I cook. You eat. Let's be friends. Eat Drink Thanks: Thanksgiving Trailer. Vodka Soda Three Ways. Layered Potato and Spinach Enchiladas. I love Lynne Rossetto Kasper. Thai-Inspired Butternut Squash Soup. Aperitif from a Jug. Thai-Inspired Butternut Squash Soup. February 21, 2011. Hey, everyone. I have my first cooking video ready for you! Not in the market to learn to make a new dish today? Yeah You’re sold. It was truly a disgusting mess. So why did it keep me in the kitchen? In th...
TOTAL LINKS TO THIS WEBSITE
3
perfectlyimperfectcreationz.blogspot.com
Perfectly Imperfect Creationz
Tutorials, Articles, and more! Wednesday, May 20, 2015. How to create your own custom brushes in Pixlr. Check out the DIGI SCRAP CAFE. Website for everything about our services and products. Links to this post. Thursday, October 2, 2014. Special Designer CU Freebie. Special Freebie on this blog only! Be sure to visit and join the Cafe for. More freebies, challenges, and fun! Check out the DIGI SCRAP CAFE. Links to this post. Sunday, April 20, 2014. New at my Art Store. Browse Digital Wood Canvas. Lion Ki...
pidesigns
Perfectly Imperfect Designs
Let us brighten your world. Click here to edit title. Click here to edit text. Click here to edit title. Click here to edit text. At Perfectly Imperfect Designs, we "repurpose", recycle" and "reuse" various everyday items that most of us throw away. We call our crafts PERFECTLY IMPERFECT DESIGNS. Because by using "used" items, they are scratched, dented, chipped. . . im. Perfect, then we design them into "perfect" gift ideas. Check back later for new updates to our website. There's much more to come!
perfectlyimperfectdeuces.skyrock.com
PerfectlyImperfectDeuces's blog - Bitch don't kill my vibe. ✔ - Skyrock.com
More options ▼. Subscribe to my blog. Created: 08/08/2012 at 7:15 AM. Updated: 23/06/2013 at 9:57 AM. Bitch don't kill my vibe. ✔. This blog has no articles. Subscribe to my blog! Post to my blog. Here you are free.
perfectlyimperfectdg.wordpress.com
Perfectly-Imperfect Domestic Gal | Just a recovering perfectionist learning to enjoy her day to day life
About the Perfectly-Imperfect Domestic Gal. Just a recovering perfectionist learning to enjoy her day to day life. December 23, 2014. This is why we send Evie to school. Love our big helper. October 2, 2014. She gets about half of them in the right spot…and keeps herself busy for a few minutes! September 18, 2014. I love this video because you can see the absolute joy on Evie’s face at the end of the slide…she loves them! April 20, 2013. As we frequently do with some of our unknown vegetables, we used th...
perfectlyimperfectfamilyandfinances.com
Perfectly Imperfect Family and Finances
Perfectly Imperfect Family and Finances. A couples thoughts on faith, family, and finances. 30’s Personal Finance: It’s Not Too Late. Posted By Mr. Imperfect. On January 25, 2011. The best time to start saving mathematically may have truly been years ago; realistically the best time is now. Don’t beat yourself up and think about all the bad decisions you made financially-focus on the good choices you made. You did not make any you say? This is free money! How hard am I willing to work and what will I sac...
perfectlyimperfectfamilyandfinances.wordpress.com
Perfectly Imperfect Family and Finances | A couples thoughts on family, faith, finances, and fun!
Perfectly Imperfect Family and Finances. A couples thoughts on family, faith, finances, and fun! Posts available at our new domain. May 8, 2008. May 6, 2008. We have moved to our new domain, PerfectlyImperfectFamilyandFinances. And will resume posting in the next couple of days. Stop by, shoot us an email and tell us what you think. Have a great day! Frugal Fun With a Child. March 11, 2008. It is such a simple thing to do. Mostly all that is required is time and a little creativity. It gives the ...Was t...
Attadmin
Home
Hello, and welcome to my site! My name is Gina Springhower and I'm an independent paraplegic who strives to live life to the fullest and inspire others to do so too! I've lived the life of both an able-bodied and now a disabled young adult. Twenty-one years of my life I spent walking, tumbling, dancing, and playing sports. Today, I still do all of those things with one little change, I roll. Please, come on in and read more about my journey in this amazing thing called life!
perfectlyimperfectgina.wordpress.com
Perfectly Imperfect Gina
6 months later…. July 13, 2016. July 13, 2016. So it’s been 6 months since I’ve blogged, and believe me I’ve had every intention of doing it before now, I just got busy doing other things and put it on the back burner. So I apologize if anyone has been looking for updates from the “paralyzed momma” before now. But here I am! Here to update you on motherhood from my set of wheels! 8221; The answer is YES! Again, like the contractions I felt some pain but nothing like an able-bodied person I’m sure&#...
