perfectlyimperfecthome.blogspot.com
Perfectly Imperfect HomeOne mom's way to make daily life neat and organized...while learning how to mix in a little style.
http://perfectlyimperfecthome.blogspot.com/
One mom's way to make daily life neat and organized...while learning how to mix in a little style.
http://perfectlyimperfecthome.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.3 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
2
SITE IP
172.217.11.33
LOAD TIME
0.328 sec
SCORE
6.2
Perfectly Imperfect Home | perfectlyimperfecthome.blogspot.com Reviews
https://perfectlyimperfecthome.blogspot.com
One mom's way to make daily life neat and organized...while learning how to mix in a little style.
perfectlyimperfecthome.blogspot.com
Perfectly Imperfect Home: December 2012
http://perfectlyimperfecthome.blogspot.com/2012_12_01_archive.html
One mom's way to make daily life neat and organized.while learning how to mix in a little style. My kids have pretty much given up naps :-(. But today for some reason both have decided it was a napping time of day. I think they know they need all if their energy to hang with Grandmom tonight! This is how I found the girl.tucked in and all snug in her tent . Tonight I am taking a quick breather to blog! YesI said this is my break! It's a crazy time.but it's time to be with family! Now on to Christmas :-).
Perfectly Imperfect Home: January 2013
http://perfectlyimperfecthome.blogspot.com/2013_01_01_archive.html
One mom's way to make daily life neat and organized.while learning how to mix in a little style. Jake and I needed some time together.he needed a break from the hustle of everyday and I need a morning of just the two of us. A Mommy and son date! So we took off for breakfast at our favorite place. Counter service at The Pop Shop and his favorite breakfast. He was a happy boy and I was a happy momma! He is growing up so fast.finding it hard to let him go! Where has the time gone? She has grown so much.
Perfectly Imperfect Home: August 2012
http://perfectlyimperfecthome.blogspot.com/2012_08_01_archive.html
One mom's way to make daily life neat and organized.while learning how to mix in a little style. Growing up we didn't vacation at the beach. We day tripped from home which is only an hour away. Or we would stay with my great grandmother who lived about 15 minutes from the beach. Still day tripping. So leaving the beach was not an option when we wanted to sleep. We have always just napped right on our chairs or blanket. But since I have had kids napping on the beach hasn't happened. It was a hot day!
Perfectly Imperfect Home: November 2012
http://perfectlyimperfecthome.blogspot.com/2012_11_01_archive.html
One mom's way to make daily life neat and organized.while learning how to mix in a little style. I know I have been MIA from the blogging world {facebook and instagram haven't suffered though}. I have been sewing, shopping, and cooking my heart out.welcome Thanksgiving and the Christmas season! Hope you had plenty of turkey and family time! But for the next few weeks I will be planning out my little girl's 4th birthday party! So I am looking forward to lots of crafting, lots of pink, and lots of love!
Perfectly Imperfect Home: July 2012
http://perfectlyimperfecthome.blogspot.com/2012_07_01_archive.html
One mom's way to make daily life neat and organized.while learning how to mix in a little style. Pinterest Friday.Fruit and Veggie Wash. I love this one! It's simple and quick. Jo-Anna over at A Pretty Life. Posted the way she washes her fruits and veggies to make sure they are super clean! I love it because you just pop all your fruit right in a clean sink, filled with luke warm water and a cup of vinegar. Then a quick rinse and dry out on the counter. Pinterest Friday.Art board. Check it out here.
TOTAL PAGES IN THIS WEBSITE
19
the-girl-who-ate-everything.com
Football Kickoff - Buffalo Chicken Dip - The Girl Who Ate Everything
http://www.the-girl-who-ate-everything.com/2009/09/football-kickoff-buffalo-chicken-dip.html
The Girl Who Ate Everything. Earning my name, one bite at a time. Tried and True Recipes. Soups, Salads, Sides, and Beverages. St Patrick’s Day. Pinned over a Million Times. Meet “The Girl”. Meet “The Girl”. Food Shirts for the Foodie. Football Kickoff – Buffalo Chicken Dip. Mon, 07 Sep 2009. This Buffalo Chicken Dip is one of the most popular recipes on the blog. Creamy and full of spiciness that all men love, this dip will be the most popular dip for watching the game. Frac12; cup Ranch dressing. Tue, ...
TOTAL LINKS TO THIS WEBSITE
2
perfectlyimperfectfamilyandfinances.com
Perfectly Imperfect Family and Finances
Perfectly Imperfect Family and Finances. A couples thoughts on faith, family, and finances. 30’s Personal Finance: It’s Not Too Late. Posted By Mr. Imperfect. On January 25, 2011. The best time to start saving mathematically may have truly been years ago; realistically the best time is now. Don’t beat yourself up and think about all the bad decisions you made financially-focus on the good choices you made. You did not make any you say? This is free money! How hard am I willing to work and what will I sac...
perfectlyimperfectfamilyandfinances.wordpress.com
Perfectly Imperfect Family and Finances | A couples thoughts on family, faith, finances, and fun!
Perfectly Imperfect Family and Finances. A couples thoughts on family, faith, finances, and fun! Posts available at our new domain. May 8, 2008. May 6, 2008. We have moved to our new domain, PerfectlyImperfectFamilyandFinances. And will resume posting in the next couple of days. Stop by, shoot us an email and tell us what you think. Have a great day! Frugal Fun With a Child. March 11, 2008. It is such a simple thing to do. Mostly all that is required is time and a little creativity. It gives the ...Was t...
Attadmin
Home
Hello, and welcome to my site! My name is Gina Springhower and I'm an independent paraplegic who strives to live life to the fullest and inspire others to do so too! I've lived the life of both an able-bodied and now a disabled young adult. Twenty-one years of my life I spent walking, tumbling, dancing, and playing sports. Today, I still do all of those things with one little change, I roll. Please, come on in and read more about my journey in this amazing thing called life!
perfectlyimperfectgina.wordpress.com
Perfectly Imperfect Gina
6 months later…. July 13, 2016. July 13, 2016. So it’s been 6 months since I’ve blogged, and believe me I’ve had every intention of doing it before now, I just got busy doing other things and put it on the back burner. So I apologize if anyone has been looking for updates from the “paralyzed momma” before now. But here I am! Here to update you on motherhood from my set of wheels! 8221; The answer is YES! Again, like the contractions I felt some pain but nothing like an able-bodied person I’m sure&#...
perfectlyimperfecthome.blogspot.com
Perfectly Imperfect Home
One mom's way to make daily life neat and organized.while learning how to mix in a little style. It was a great way to spend time with the hubby and kids. Turtles, Ducklings, and Scooters.Oh My! We have been having some awesome weather here in S.J. so last week the kiddos and I decided to head to our town park. You wouldn't know it but we have a pretty beautiful park complete with a lake and all the creatures that go with it! But we are not slowing down for a minute. And, I do have so much to share!
perfectlyimperfecthr.deviantart.com
PerfectlyImperfectHr (Nicole) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Deviant for 6 Years. This deviant's full pageview. Last Visit: 338 weeks ago. This is the place where you can personalize your profile! By moving, adding and personalizing widgets. Why," you ask?
perfectlyimperfecthuman.wordpress.com
perfectlyimperfecthuman
Welcome to my blog! To keep it short and sweet, I literally write about anything and everything that crosses my mind. It’s a free world, enjoy! Peace and love,. Perfectly imperfect human xo. This is just a short excerpt for the about page. This is just a short excerpt for the contact page. Today’s thoughts: I miss him. Read more Today’s thoughts: I miss him. Front Page One Text Widget. Front Page Two Text Widget. Footer Three Menu Widget. Today’s thoughts: I miss him. My first blog post!
perfectlyimperfectible.blogspot.com
Constant Change
The Law of Constant Change as a fundamental law of our life that needs to be both understood and harnessed if we are to have a happy and successful life. The Law states that everything in our life is in constant change, constantly in the process of becoming something else. Nothing stays exactly as it is. Nothing. Movement and change constitute the reality of our being. Tuesday, February 12, 2013. That which no longer serves me. It's time for a change. Tuesday, February 12, 2013. Links to this post. Watch...
Perfectly Imperfect Images-Fort Wayne Photographer
perfectlyimperfectinchicago.blogspot.com
It doesn't have to be perfect to be wonderful...
It doesn't have to be perfect to be wonderful. Friday, January 10, 2014. Wow, where to begin . . . Eden was born on Dec. 1st, but here we are almost 6 weeks later, and I'm finally stealing a moment to blog about it. Thanks to my dear friend, Sarah, for encouraging me to do so. I know these memories will elude me too quickly, and this little angel is changing on a daily basis. Tuesday, November 12, 2013. The more I think about it, it's just an ugly thing to ask. What is one to say? All I'm really sure of ...
SOCIAL ENGAGEMENT