pheaseyfarm.wordpress.com
Voices of Pheasey Park farm estate | recollections from Pheasey Park farm estaterecollections from Pheasey Park farm estate (by Pheasey Park farm estate)
http://pheaseyfarm.wordpress.com/
recollections from Pheasey Park farm estate (by Pheasey Park farm estate)
http://pheaseyfarm.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
0.6 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
15
SSL
EXTERNAL LINKS
44
SITE IP
192.0.78.13
LOAD TIME
0.583 sec
SCORE
6.2
Voices of Pheasey Park farm estate | recollections from Pheasey Park farm estate | pheaseyfarm.wordpress.com Reviews
https://pheaseyfarm.wordpress.com
recollections from Pheasey Park farm estate (by Pheasey Park farm estate)
pheaseyfarm.wordpress.com
Memories of Queslett sand and gravel pit | Voices of Pheasey Park farm estate
https://pheaseyfarm.wordpress.com/2012/05/09/memories-of-queslett-sand-and-gravel-pit
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. Posted by: Pheasey Park farm estate. May 9, 2012. Memories of Queslett sand and gravel pit. Memories have been left about Queslett road sand and gravel pit. Read more…. Laquo; Interactive Map. Help us remember the Silver Jubilee. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your Twitter account. ( Log Out.
Queslett Sand and Gravel Company | Voices of Pheasey Park farm estate
https://pheaseyfarm.wordpress.com/places/queslett-sand-and-gravel-company
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. Queslett Sand and Gravel Company. Memories of Queslett Sand and Gravel Company’s pit. This occupied Queslett Road from Booths Lane to the Aldridge road and was some 147 acres. Quesslett Quarry source http:/ b43.co.uk/cms/content/view/349/460/. Memories of Albert Busby. Memories of Peter Hillcox. RMC works in the 1920’s. Source http:/ b43.co.uk/cms/content/view/349/460/. On May 9, 2012. Leave a Reply Cancel reply.
About | Voices of Pheasey Park farm estate
https://pheaseyfarm.wordpress.com/about
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. Voices of Pheasey farm estate project is lead by Chris Hillcox and is run in partnership with the community of Pheasey, Great Barr, and Kingstanding. To contact the project please use the comment box on this web site or email directly at chrishillcox1@hotmail.com . Telephone 07783903096. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public).
History | Voices of Pheasey Park farm estate
https://pheaseyfarm.wordpress.com/history
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. A complete history of the Pheasey estate can be found at http:/ billdargue.jimdo.com/placenames-gazetteer-a-to-y/places-p/pheasey/. Construction site on the Pheasey Estate. The name of the Pheasey estate derives from the family name, Vesey. Nearby Park Farm, the home farm of the Great Barr. Estate was also sold for housing soon after the war, development continuing until 1981. Leave a Reply Cancel reply. You are commenting u...
Recollections of Evangelical church | Voices of Pheasey Park farm estate
https://pheaseyfarm.wordpress.com/2012/08/29/recollections-of-evangelical-church
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. Posted by: Pheasey Park farm estate. August 29, 2012. Recollections of Evangelical church. Helen Pallett recalls Pheasey Evangelical church. Read more…. Laquo; Help us remember the Silver Jubilee. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Voices of Allen's Cross.
TOTAL PAGES IN THIS WEBSITE
15
voicesofbirmingham.wordpress.com
About | Voices of Birmingham
https://voicesofbirmingham.wordpress.com/about
Saving the memories of the city. Voices of Birmingham is a project to record the oral histories of Birmingham residents. the project will focus on 1930’s to the 1950’s. It will also emphasise recollections from people who once lived in the cities council estates but will also draw from private housing estates in the city. When complete the oral histories will be donated to Birmingham Central library. Leave a Reply Cancel reply. Enter your comment here. Address never made public). Voices of North Cross.
Christ the King Catholic Church | Voices of Kingstanding
https://kingstanding.wordpress.com/memories/ammenaties/churches/christ-the-king-catholic-church
Memories of Kingstanding estates from the beginning to today. Christ the King Catholic Church. Christ the king Catholic Church. A short history of Christ the King parish. This booklet has been produced to mark eighty years since the foundation of our parish and fifty years since the current church building opened. We marked the occasion with Mass celebrated on the First Sunday of Advent, 2. Where it all began. Why Christ the King Church? Fr Michael Byrne: 1932-1941-. Fr John Clancy: 1958-1986. Father Byr...
Coronation Day at Cranbourne Road School | Voices of Kingstanding
https://kingstanding.wordpress.com/2013/04/23/coronation-day-at-cranbourne-road-school
Memories of Kingstanding estates from the beginning to today. Posted by: Voices of Kingstanding. April 23, 2013. Coronation Day at Cranbourne Road School. Photographs of the celebrations of Coronation Day at Cranbourne road school have been posted. Read more…. Laquo; Picture of Hartley Road on VE day. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). You are commenting using your WordPress.com account. ( Log Out. Hare ...
Interactive Map | Voices of Kingstanding
https://kingstanding.wordpress.com/2011/07/31/interactive-map
Memories of Kingstanding estates from the beginning to today. Posted by: Voices of Kingstanding. July 31, 2011. Use the interactive map to click into places and memories. Laquo; Leave your memories here! Dulwich Road Secondary modern memories added. That area was known as the “Davis” estate and was not developed until after the war, some of the roads had been laid prior to the war but the whole area was used as farm land until building recommenced in 1945/6. On April 25, 2012. Leave a Reply Cancel reply.
History | Voices of Kingstanding
https://kingstanding.wordpress.com/kingstandings-history
Memories of Kingstanding estates from the beginning to today. William Dargue’s web site, ‘A history of Birmingham Places and Names’ provides an interesting insight into the development of the estate. He wrote. 8216;The extensive housing estates of Kingstanding were built after 1928 on land previously under the control of Perry Barr District Council. The estate is centred on the junction of Kingstanding Road and Kings Road. The Kettlehouse farm Estate. The Warren Farm Estate. Http:/ www.search.dig...A map...
Recollection book on Kingstanding | Voices of Kingstanding
https://kingstanding.wordpress.com/2013/01/27/recollection-book-on-kingstanding
Memories of Kingstanding estates from the beginning to today. Posted by: Voices of Kingstanding. January 27, 2013. Recollection book on Kingstanding. Dear All, I have started work on a book on Kingstanding using the memories and recollections recorded in the project. I will update the blog with my progress but if there is anything people would like included then please let me know. All the best for 2013 – Chris Hillcox. Laquo; Early photo unearthed from Dulwich Road Junior school. Enter your comment here.
Christ the King church archive published | Voices of Kingstanding
https://kingstanding.wordpress.com/2012/11/28/christ-the-king-church-archive-published
Memories of Kingstanding estates from the beginning to today. Posted by: Voices of Kingstanding. November 28, 2012. Christ the King church archive published. An archive of photographs from Christ the King has now been published. It includes photos from it’s early days in College Arms ‘assembly room’ to the modern church in the 1960’s. Read more…. College Arms ‘assembly room’ 1930’s. Laquo; Donations sort for professional Oral history Voice recorder. Early photo unearthed from Dulwich Road Junior school.
Interactive Map | Voices of Great Barr
https://greatbarr.wordpress.com/2012/05/24/interactive-map
Voices of Great Barr. Part of the Voices of Birmingham Oral History Project. May 24, 2012. Click on the map and follow the links to memories. Laquo; Voices of Great Barr. Born 1948, living in Foden Rd, went to Calshot Rd Schools, played in woods on Walsall Rd, Christened and married at St Pauls Hampstead. Still best mates with schoolmates. On June 16, 2012. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Address never made public). Create a fre...
Hamstead Junior school photos | Voices of Great Barr
https://greatbarr.wordpress.com/2012/09/09/hamstead-junior-school-photos
Voices of Great Barr. Part of the Voices of Birmingham Oral History Project. September 9, 2012. Hamstead Junior school photos. Cedric Barker has kindly shown us a copy of the Hamstead and Great Barr Herrald which includes photographs and memories from Hamstead Junior school. Read more…. Laquo; Georgina Miller recalls Hamstead village school. Credric Barker recalls Hamstead Colliery. Leave a Reply Cancel reply. Enter your comment here. Fill in your details below or click an icon to log in:. Georgina Mille...
TOTAL LINKS TO THIS WEBSITE
44
pheasent.com
The domain pheasent.com is for sale. To purchase, call Afternic.com at 1 781-373-6847 or 855-201-2286. Click here for more details.
Barneys Driving Academy
Welcome to Barneys Driving Academy. Now incorporating Pheasey Driving School. The vehicle used is a dual controlled Vauxhall Corsa sxi,. With all the refinements you would expect to find in a full spec modern and agile car of the 21st century. Barneys Driving Academy offers a door to door pick up service,. You could even drive yourself to or from your place of work! Thinking about taking the first step? Two free ebooks available to help you below. All surrounding areas considered.
News and Views about Pheasey Park Farm
News and Views about Pheasey Park Farm. Views From Barr Beacon. Cat and Fiddle, Trees and Old Horns. Councillor and MP Details. Been a while but movement on Great Barr Hall? So after a quiet period two interesting pieces of news has appeared. The first is that the land owners – Great Barr Lakes submitted a planning application and got it approved for works to the Lake. The full link to this application is HERE and this is work I mentioned quite a while back that had…. Continue reading →. A bit of news to...
Cimberleigh Pheasey's blog
De arbeidsmarkt in Spanje-Authorstream. Http:/ www.authorstream.com/Presentation/joshuaaken7-1591042-tyler-group/. Werkloosheid in Spanje, ondanks een daling in de afgelopen jaren blijft relatief hoog in vergelijking met andere Europese landen en de neiging om te beginnen weer te stijgen in begin 2009. Echter, sommige sectoren nog steeds bieden professionele kansen voor buitenlanders, met inbegrip van marketing, import-export, professor, vertaling en nieuwe technologieën. Nov 13, 2012 11:14:17 PM. I Ryss...
Pheasey Allotment | Welcome to Pheasey Allotment website
Pheasey allotment in Great Barr, is one of four sites run by the BGPW local management Association which is based in Walsall. Pheasey Allotment, Great Barr, Birmingham, West Midlands, B43 7DB. Welcome to Pheasey Allotment website. Our allotment is situated in the Great Barr area. It is one of four sites run by the BGPW local management Association which is based in Walsall. Contact us: pheasey.allotment@btinternet.com. Is generated by the Met Office Weather Widget. Using Cambridge Open Systems.
Voices of Pheasey Park farm estate | recollections from Pheasey Park farm estate
Voices of Pheasey Park farm estate. Recollections from Pheasey Park farm estate. Posted by: Pheasey Park farm estate. August 29, 2012. Recollections of Evangelical church. Helen Pallett recalls Pheasey Evangelical church. Read more…. Posted by: Pheasey Park farm estate. May 9, 2012. Posted by: Pheasey Park farm estate. May 19, 2012. Help us remember the Silver Jubilee. Or call 07783903096. Thank you. Posted by: Pheasey Park farm estate. May 9, 2012. Memories of Queslett sand and gravel pit. April 24, 2012.
Pheasey Park Farm Labour
Pheasey Park Farm Labour. Tuesday, 19 August 2014. New Website for Pheasey Labour. Due to some issues with blogspot, we are moving the website to. Https:/ pheaseylabour.wordpress.com. This site will not be deleted but no longer maintained and all new content will be placed onto the new address. Please change your bookmarks to reflect this. Saturday, 24 May 2014. Just had the very sad news that Tim Oliver the leader of Walsall Labour Party has sadly passed away today. Wednesday, 21 May 2014. Other parties...
Pheasey Labour Party | Blog of the Pheasey Labour Party
Blog of the Pheasey Labour Party. About Pheasey Labour Party. Withdrawal of Ian Robathan from local elections. January 9, 2015. We have to announce today that Ian Robathan has had to withdraw from the 2015 elections. This is Ian’s personal statement. 8216;Tonight I have informed Walsall Labour Party that I have had to withdraw my candidature from the 2015 election for Pheasey Park Farm ward. I am devastated for doing this but I am in no position to continue as the Labour candidate for 2015. Ian is an IT ...
pheaseyparkfarmchildrenscentrenursery.co.uk
Home | Pheasey Park Farm Children's Centre Nursery
Pheasey Park Farm Childrens Centre Nursery, Great Barr - Welcome to our new nursery website! No diary entries to display. October Half Term Play Scheme. Web Site Designed by PrimarySite.
Pheasant Ridge Associates
Provides internet-based voter management and political analysis software, website development and political and campaign planning consultation for Republican candidates, elected officials and party units and for organizations/PACs espousing the basic principles of the Republican Party. Pheasant Ridge Associates. Offers the following products and services:. BITS Voter Management System. Database software to manage, record, report on and maintain a voter information database (internet-based).
