A practically perfect life of junkin', selling, cooking, reminiscing, & DIY'ing - come on in!
http://practicallyperfectlife.wordpress.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
6.1 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
8
SSL
EXTERNAL LINKS
1
SITE IP
192.0.78.13
LOAD TIME
6.078 sec
SCORE
6.2
Hippie Huckster | A practically perfect life of junkin', selling, cooking, reminiscing, & DIY'ing – come on in! | practicallyperfectlife.wordpress.com Reviews
https://practicallyperfectlife.wordpress.com
A practically perfect life of junkin', selling, cooking, reminiscing, & DIY'ing - come on in!
practicallyperfectlife.wordpress.com
My Sunroom Makeover | Hippie Huckster
https://practicallyperfectlife.wordpress.com/2015/09/27/my-sunroom-makeover
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! September 27, 2015. Our house has an absolutely delightful sunroom that was being sadly neglected and under used. Here’s photographic proof:. I visualized a lovely, cozy retreat for myself with a funky vintage, shabby chic feel. Where to start? Tam immediately proceeded to chalk paint an old, brown, cobwebby desk she had dug out of her barn and this fabulous chair from my mom’s supply of vintage pieces. You ar...
Best Croutons Ever! | Hippie Huckster
https://practicallyperfectlife.wordpress.com/2013/02/26/best-croutons-ever
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! February 26, 2013. As I am prone to do, I modified the Pioneer Woman’s recipe a bit. Italian Bread, olive oil, garlic cloves, fresh rosemary, sea salt. You can use French bread or whatever. You could also try different herbs or crushed red pepper. And/or flaxseed! Occasionally, I like to sneak a tad of nutrition into stuff. Preheat oven to 200 degrees. Cut bread into 1 inch cubes and spread onto a baking sheet.
Bison Chili | Hippie Huckster
https://practicallyperfectlife.wordpress.com/2015/02/10/bison-chili
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! February 10, 2015. Like most chili eaters, I made up my own recipe for this thick, hearty, comfort soup. And it goes a little somethin’ like this. Ground Bison – 1 pound. Tomato Puree or Crushed Tomatoes – 28 oz can. Vegetable Broth – 1 cup. Onion – 1 diced. Garlic Cloves – 2 or 3 minced. Kidney Beans and/or Pinto Beans and/or Black Beans – 15 oz can each of two varieties. Salt – 2 tsp. Water – 1/2 cup. 7 Top ...
Last day, first post | Hippie Huckster
https://practicallyperfectlife.wordpress.com/2016/06/20/last-day-first-post
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! Last day, first post. June 20, 2016. Captain’s Log, Day 9:Lord, bubby. Re-entry to reality. Paradise lost. My Brigadoon enchantment broken. 8220;Tina” brought us bleachy water and hot coffee which slightly diverted my attention from the loud waitresses squawking at each other and flirting with the chubby old regulars on oxygen at the bar. About Practically Perfect Life. Leave a Reply Cancel reply. Stop letting...
Stop letting the imperfect tell you how to love yourself! | Hippie Huckster
https://practicallyperfectlife.wordpress.com/2015/10/29/stop-letting-the-imperfect-tell-you-how-to-love-yourself
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! Stop letting the imperfect tell you how to love yourself! October 29, 2015. If you assess your self-worth by the cut of your muscles and size of your clothes, then work on letting that sick mentality go to get yourself emotionally healthy. Read this excerpt from Glennon Melton’s blog. The daily deluge of images of women’s bodies for sale and the onslaught of emaciated women’s bodies held up as the pinnacle of ...
TOTAL PAGES IN THIS WEBSITE
8
deconstructioncrafts.wordpress.com
{ DIY Projects } – Deconstruction Crafts
https://deconstructioncrafts.wordpress.com/we-can-do-it-diy-projects
Unpacking what's so to see what's possible. If you’re looking for instructions for one of my kits, come over here! The world of handmade is having a come-back. This is one trend that I’m obviously loving! Is it furthering something or promoting something? Is it using renewable, low processed, or used materials? Is it making something more efficient? Check out my projects/DIY by Deconstruction Crafts. See my collection of Tutorials. Which have steps included. Image above is by Mass Media Bazaar.
TOTAL LINKS TO THIS WEBSITE
1
Practically Perfection - Home
practicallyperfection.wordpress.com
Not My Forte | If music be the food of love, play on.
If music be the food of love, play on. SOTD, I Will Always Love You – Dolly Parton. May 31, 2016. 8220;But this song is by Whitne. I hear you all cry. Contrary to popular belief, Dolly Parton wrote and originally performed this song as Miss Mona for the 1982 comedy musical film. The Best Little Whorehouse in Texas. Version – at a gig in Cambridge. On Friday, so I thought I would share with you all the wonder that is Miss Dolly. Go and watch the film, it’s incredible. Song of the Day. May 29, 2016. So my ...
practicallyperfectjewellery.com
Practically Perfect | A jewellery journey
The antidote to mass-produced tat. Bare Copper vs Non-tarnish. My ‘tutors’. Welcome to Practically Perfect! Do you love to be unique? Hate most of the mass-produced, expensive junk from chain jewellery stores? Ever walked into a party and met the horror of someone else wearing your outfit? If you answered ‘yes’ to any of those questions, this site – and its accompanying shop. 8211; has been built for you. Handmade copper jewellery is the answer that fits all of the above and more. November 29, 2015.
practicallyperfectkitchenmama.com
Practically Perfect Kitchen Mama | always looking for the perfect kitchen
Practically Perfect Kitchen Mama. Always looking for the perfect kitchen. ESW hosts NKBA dinner. I will never grill meat again in my kitchen. Before we moved into our last house, I fell in love with Wolf’s 48″ stove with the infrared grill at the … Continue reading →. September 18, 2013 · 1 Comment. People generally think of style when they embark on the task of redoing their kitchen and they most likely will start by looking at styles that goes with their house. … Continue reading →.
Practically Perfect – Los Angeles Professional Organizing
Los Angeles Professional Organizing. Practical Solutions. Perfect Organization. Practically Perfect is a Los Angeles based company devoted to constructing creative and functional organizing solutions that simplify daily activities, maximize space and exemplify practical perfection. Practically Perfect, LLC is a member of the National Association of Professional Organizers and adheres to their professional code of ethics.
practicallyperfectlife.wordpress.com
Hippie Huckster | A practically perfect life of junkin', selling, cooking, reminiscing, & DIY'ing – come on in!
A practically perfect life of junkin', selling, cooking, reminiscing, and DIY'ing – come on in! Last day, first post. June 20, 2016. Captain’s Log, Day 9:Lord, bubby. Re-entry to reality. Paradise lost. My Brigadoon enchantment broken. 8220;Tina” brought us bleachy water and hot coffee which slightly diverted my attention from the loud waitresses squawking at each other and flirting with the chubby old regulars on oxygen at the bar. I love it that we are sisters. March 26, 2016. BE THE CHURCH. Yes. Room ...
www.practicallyperfectliving.com
This site is under construction. Why am I seeing this page? Are you the owner of this domain? How to replace this page. Try these searches related to www.practicallyperfectliving.com:. Corel Word Perfect 12. Word Perfect Office 12. Word Perfect Office 11. Corel Word Perfect 11. Word Perfect Office 2002. 13 Corel Perfect Word. Corel Word Perfect 9. Corel Word Perfect 10. Corel Word Perfect 2000. Corel Word Perfect 2002. Corel Word Perfect 7. Corel Word Perfect 8.
practicallyperfectmummy.blogspot.com
Practically Perfect Mummy
My quest to be a Practically Perfect Mummy. Saturday, September 04, 2010. My son has developed a very annoying new habit - if ever I ask him to do something he doesn't want to do he only bothers to give me half a reply finishing the sentence with 'blah blah blah'. ARRRRG! Me: "Can you put you shoes on please, we are going out.". Son: "No thanks, I am happy here blah blah blah". Me: "Why don't you go outside and play? Son " No thanks, its to blah blah blah". Son: "I don't want to it's blah blah blah".
Practically Perfect Mums - Family Travel and Other Adventures!
Press & Media. Family Travel: Taking 5 on Holiday. Bristol & Portishead. Portishead Kid’s Activities Weekly Planner. Events Calendar Portishead & Beyond. Special Events Portishead & Beyond. Me V the House. Noah’s Ark: Family Focus on The Biggest Zoo in the South West! 5 UK Family Travel Blogs Worth Checking Out! Dreaming of a holiday but not sure where to start? Today I bring you five UK Family Travel Blogs – great sources of inspiration for your next day out, short break or family holiday.
practicallyperfectok.webnode.com
*
We have a new website. Please go to www.practicallyperfectconsignment.com. Mdash;————. Mdash;————. Mdash;————. Mdash;————. Mdash;————. Mdash;————. 160;Sale Days Thursday Friday April 2nd and 3rd (open to the public) 10am 8 pm Half Price Sale Saturday, April 4th (open to the public) 10am 2pm Consignors Pre-Sale Wednesday, April 1st 7pm 9pm (Working consignors will be allowed to shop one hour earlier at. Mdash;————. Why be a consignor? Mdash;————. Mdash;————. Mdash;————. Robyn Davidson or Lisa Wingo.
Home - Practically Perfect PA
Working with multiple Execs. Working with the Exec Team. Technology of the week. Virtual Summit Summer 2018. Virtual Summit Winter 2018. Online Course: The Future Assistant 2018. Online Course: Virtual Summit 2017. Making good assistants great. Tech of the week: Get The Flight Out. Today’s Technology of the week: Get The Flight Out. Here are all the details. Read More ›. Kick start your motivation. Read More ›. Five prioritising tips for PAs. Read More ›. See all of our blog posts. You know when you̵...
SOCIAL ENGAGEMENT