SALTLAKECITYCRAIGSLIST.ORG
saltlakecitycraigslist.orgNo description found
http://www.saltlakecitycraigslist.org/
No description found
http://www.saltlakecitycraigslist.org/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.4 seconds
Jack Savage
84 Ma●●●●●treet
Wa●●ue , New York, 10005
US
View this contact
Jack Savage
84 Ma●●●●●treet
Wa●●ue , New York, 10005
US
View this contact
Jack Savage
84 Ma●●●●●treet
Wa●●ue , New York, 10005
US
View this contact
GoDaddy.com, LLC (R91-LROR)
WHOIS : whois.publicinterestregistry.net
REFERRED :
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
0
SITE IP
208.73.211.194
LOAD TIME
1.419 sec
SCORE
6.2
saltlakecitycraigslist.org | saltlakecitycraigslist.org Reviews
https://saltlakecitycraigslist.org
<i>No description found</i>
saltlakecitycountyjail.com - This website is for sale! - Jail Resources and Information.
The domain saltlakecitycountyjail.com. May be for sale by its owner! The domain saltlakecitycountyjail.com. May be for sale by its owner! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
saltlake City Couriers | Couriers Salt Lake City , 801-682-2683
Couriers Salt Lake City , 801-682-2683. SALT LAKE CITY COURIER SERVICES. We provide same-day shipping and door-to-door delivery service within Salt Lake City, Utah and the surrounding areas. Leading same day couriers in Canada and the USA. Wide range of door-to-door fulfillment for clients of all sizes and needs. Facilitate deliveries 24/7, 365 days a year. Courier services for point-to-point delivery in 1-6 hours. Online order entry and real time order tracking system. Fast, efficient and affordable cou...
Saltlakecitycoworking.com
saltlakecitycpas.com
This Domain Name may be for sale. Please contact us. Salt Lake City Hotels. Salt Lake City Airport. Salt Lake City Lodging. Salt Lake City Skiing. Salt Lake City Utah Lodging. Salt Lake City Apartments. Salt Lake City Hotels. Salt Lake City Airport. Salt Lake City Lodging. Salt Lake City Skiing. Salt Lake City Utah Lodging. Salt Lake City Apartments. Salt Lake City Ut Hotel. Salt Lake City Travel. Downtown Salt Lake City. City Computer Job Lake Salt. Salt Lake City Hotels. Salt Lake City Utah Hotels.
saltlakecitycraigslist.com
saltlakecitycraigslist.org
saltlakecitycrimescenecleanup.com
SALT LAKE CITY CRIME SCENE CLEANUP | Salt Lake City crime scene cleanup 24 hr
SALT LAKE CITY CRIME SCENE CLEANUP. SALT LAKE CITY CRIME SCENE CLEANUP 24HR. CRIME AND TRAUMA SCENE CLEANUP. SUB CONTRACT WORK AVAILABLE NATIONWIDE. SUICIDE-BLOOD-MURDER-UNATTENDED DEATH REMOVAL-DECOMPOSITION-FORENSICS-TRAUMA-MEDICAL ACCIDENTS-24 HR EMERGENCY SERVICE. CRIME SCENE CLEANUP ONLINE TRAINING / DVD. Homicide,Blood,Trauma,Death,Victims,Cleaning. Suicides,Scene Cleanup,Janitorial,Carpet,Floors. Unattended Deaths,Human Decomposition,Bodily Fluids. Decompositions,Maggots,Human,Animals,Odor Control.
saltlakecitycriminalattorney.com
saltlakecitycriminalattorney.com
This Domain Name may be for sale. Click here to submit an offer. Inquire about this domain.
saltlakecitycriminalattorneys.com
saltlakecitycriminalattorneys.com
This Domain Name may be for sale. Click here to submit an offer. Inquire about this domain.
saltlakecitycriminaldefense.net
Attorney Salt Lake City, UT ( Utah ) - Larry Long Lawyer Inc.
Salt Lake City, UT Attorney. Larry Long Lawyer Inc. Larry Long Lawyer Inc. has been offering complete legal representations in the Saly Lake City, UT area for over 40 years. We specialize on criminal defense. Our law firm always looks for ways to defend our clients' legal rights. We provide highly personalized attention, timely communication, and assurance that your rights will not be violated. With us, every client will be treated with utmost care and respect. Larry Long Lawyer Inc. Handles:.
saltlakecitycriminaldefenselawyers.com
saltlakecitycriminaldefenselawyers.com
Inquire about this domain.