savingmysanityoneblogatatime.blogspot.com
Saving my sanity, one blog at a time...One mans mission to not only save my own, but just maybe someone elses sanity...
http://savingmysanityoneblogatatime.blogspot.com/
One mans mission to not only save my own, but just maybe someone elses sanity...
http://savingmysanityoneblogatatime.blogspot.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
2.3 seconds
16x16
32x32
64x64
128x128
PAGES IN
THIS WEBSITE
10
SSL
EXTERNAL LINKS
0
SITE IP
216.58.219.225
LOAD TIME
2.281 sec
SCORE
6.2
Saving my sanity, one blog at a time... | savingmysanityoneblogatatime.blogspot.com Reviews
https://savingmysanityoneblogatatime.blogspot.com
One mans mission to not only save my own, but just maybe someone elses sanity...
savingmysanityoneblogatatime.blogspot.com
Saving my sanity, one blog at a time...: Utter tranquility...
http://savingmysanityoneblogatatime.blogspot.com/2013/12/utter-tranquility.html
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Monday, December 9, 2013. There is no better feeling than sand between the toes. Except the warm touch of your lips. The smell of your hair, you know how the story goes. I do that while holding your hips. Your eyes as wide and innocent as could be. I see everlasting beauty my dear. Remembering your last kiss with me. Was it our last is what I fear. To my heart and my mind.
Saving my sanity, one blog at a time...: The insanity of my darkness...
http://savingmysanityoneblogatatime.blogspot.com/2013/12/the-insanity-of-my-darkness.html
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Tuesday, December 10, 2013. The insanity of my darkness. The insanity of my darkness. Hopeful I was when we last met. I am now but forgotten. I was filled with happiness and emotion. I wipe the tears with worn cotton. I have seen greatness in rare form. My tunnel has now lost its light. Beauty inside, a heart that's warm. Yet my own now feels the fright. The love I have it's always yours.
Saving my sanity, one blog at a time...: The insanity of promises broken...
http://savingmysanityoneblogatatime.blogspot.com/2013/12/the-insanity-of-promises-broken.html
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Tuesday, December 10, 2013. The insanity of promises broken. We shared a love that was surely grand. You are perfect still even today. I wanted our love to learn to withstand. Everything they would dare to say. Will we ever be together? I always refused to say never. And bravely gave it my best shot. I realize now that I may be a fool. Thinking I could be the one. View my complete profile.
Saving my sanity, one blog at a time...: December 2013
http://savingmysanityoneblogatatime.blogspot.com/2013_12_01_archive.html
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Tuesday, December 10, 2013. The insanity of promises broken. We shared a love that was surely grand. You are perfect still even today. I wanted our love to learn to withstand. Everything they would dare to say. Will we ever be together? I always refused to say never. And bravely gave it my best shot. I realize now that I may be a fool. Thinking I could be the one. I am now but forgotten.
Saving my sanity, one blog at a time...: The insanity of the heart...
http://savingmysanityoneblogatatime.blogspot.com/2013/12/the-insanity-of-heart.html
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Friday, December 6, 2013. The insanity of the heart. The madness and insanity. The fear and despair. Of ones heart being alone. Is almost too much to bear. If only you knew. The wondrous love that awaits. And cared a little more. To accept ones fate. To take a leap of faith. Is all I ever asked. You shouldn't wait any longer. Let your heart become unmasked. Open up to it all.
TOTAL PAGES IN THIS WEBSITE
10
savingmyplanet.org - Crazy Domains
Search and register domain names. World's cheapest domain names. 700 New generic domains. Move your domains to us FREE. Express cheap domain renewal. Get the domain name you want. Everything you need for your domains. Control your CNAME, MX and A records. Find who owns a particular domain. COM only $9.00 Get yours! Join The Domain Club. Fast, reliable space for your website. Defend your site against hackers. Secure your site and data. Get your own me@mydomain.com. Automatic Spam and Virus protection.
savingmyproperty.com - Crazy Domains
Search and register domain names. World's cheapest domain names. 700 New generic domains. Move your domains to us FREE. Express cheap domain renewal. Get the domain name you want. Everything you need for your domains. Control your CNAME, MX and A records. Find who owns a particular domain. COM only $9.00 Get yours! Join The Domain Club. Fast, reliable space for your website. Defend your site against hackers. Secure your site and data. Get your own me@mydomain.com. Automatic Spam and Virus protection.
savingmysanity.com
savingmysanity (Tasha) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Deviant for 14 Years. This deviant's full pageview. July 22, 1979. Last Visit: 7 weeks ago. This is the place where you can personalize your profile! By moving, adding and personalizing widgets.
savingmysanityescapingreality.wordpress.com
Saving my sanity | This is where I'm going to deal with my reality
Time for me challenge update. March 6, 2016. I am very thankful that I decide to challenge myself to make time for me. I’m ahead in all my courses bar my dissertation (which can’t be helped I need to experiment on others hehe) and am so far averaging 75% for this year 😀. I’m feeling fitter and stronger and today noticed how strong and flexible I felt in my yoga practice I even managed to hold crow pose 😀. Time for me challenge. Trying to have a more positive mindset. February 2, 2016. At the moment I&#...
savingmysanityoneblogatatime.blogspot.com
Saving my sanity, one blog at a time...
Saving my sanity, one blog at a time. One mans mission to not only save my own, but just maybe someone elses sanity. Tuesday, December 10, 2013. The insanity of promises broken. We shared a love that was surely grand. You are perfect still even today. I wanted our love to learn to withstand. Everything they would dare to say. Will we ever be together? I always refused to say never. And bravely gave it my best shot. I realize now that I may be a fool. Thinking I could be the one. I am now but forgotten.
Recovery - Mia
Monday, 19 August 2013. Subscribe to: Posts (Atom). I dont want to make this dreary, I just want to h. View my complete profile. Travel template. Powered by Blogger.
Saving Myself | Saving Myself
See all Domains for Sale. Search our Catalogue for more Domains.
savingmyself.org - This website is for sale! - savingmyself Resources and Information.
The owner of savingmyself.org. Is offering it for sale for an asking price of 950 USD! This page provided to the domain owner free. By Sedo's Domain Parking. Disclaimer: Domain owner and Sedo maintain no relationship with third party advertisers. Reference to any specific service or trade mark is not controlled by Sedo or domain owner and does not constitute or imply its association, endorsement or recommendation.
Just YOU and ME. | And a bed and a shoreline….<3
Just YOU and ME. And a bed and a shoreline…. 3. April 29, 2010 by Denise C. So many things have changed since I started this blog (and many others after it). Please head over to my new blog to find out what’s been going in my life these days. And I sincerely apologize for not responding to your comments. I lost the password to this account and just found a way to recover it. Http:/ denistar.wordpress.com. September 3, 2008 by Denise C. Lagi tayong nag-aaway pero masaya pa rin. I feel really really sad th...
Saving Myself Money | Money Saving Tips and ways to increase your Net worth
Money Saving Tips and ways to increase your Net worth. Make some money reviewing apps! Make some money reviewing apps! Date April 1, 2015. Well in order to Save money, you need to make money first! I just found a really cool service called http:/ www.Appiness.io . Do you remember the market researcher work you may have done? Someone asks you to taste a cookie and compare it to others, rate it, etc. and in the end you get $20 for […]. Make some money reviewing apps! Make some money reviewing apps!
