{A simple, green, homeschooling family of six learning to thrive with less on a modern-day Iowa homestead.}
http://www.simplifylivelove.com/
TODAY'S RATING
#721,405
Date Range
HIGHEST TRAFFIC ON
Wednesday
LOAD TIME
0.1 seconds
16x16
DOMAIN PRIVACY SERVICE FBO REGISTRANT
10 CORPOR●●●●●●●●●SUITE 300
BUR●●●TON , MASSACHUSETTS, 01803
UNITED STATES
View this contact
DOMAIN PRIVACY SERVICE FBO REGISTRANT
10 CORPOR●●●●●●●●●SUITE 300
BUR●●●TON , MASSACHUSETTS, 01803
UNITED STATES
View this contact
DOMAIN PRIVACY SERVICE FBO REGISTRANT
10 CORPOR●●●●●●●●●SUITE 300
BUR●●●TON , MASSACHUSETTS, 01803
UNITED STATES
View this contact
BUY YOUR DOMAIN
13
YEARS
11
MONTHS
20
DAYS
FASTDOMAIN, INC.
WHOIS : whois.fastdomain.com
REFERRED : http://www.fastdomain.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
215
SITE IP
65.254.248.203
LOAD TIME
0.141 sec
SCORE
6.2
Simplify, Live, Love - {A simple, green, homeschooling family of six learning to thrive with less on a modern-day Iowa homestead.} | simplifylivelove.com Reviews
https://simplifylivelove.com
{A simple, green, homeschooling family of six learning to thrive with less on a modern-day Iowa homestead.}
simplifylivelove.com
Freezer Friendly Recipes Archives - Simplify, Live, Love
http://www.simplifylivelove.com/category/recipes/freezer-friendly-recipes
Simplify, Live, Love. Enjoy simple family living with real food, organic gardening, good fun, and lots of love. Disclosure & Privacy Policy. I’ve been featured…. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. Kid Approved Italian Stuffed Peppers in 5 Easy Steps. Make Ahead Lasagna Recipe with Cottage Cheese & Secret Veggies. Ground Beef Stroganoff for the Freezer. Chicken Oreganato for the Freezer. Easy Oven Sandwich Recipe – Perfect for Freezer Cooking.
Breakfasts Archives - Simplify, Live, Love
http://www.simplifylivelove.com/category/recipes/breakfasts
Simplify, Live, Love. Enjoy simple family living with real food, organic gardening, good fun, and lots of love. Disclosure & Privacy Policy. I’ve been featured…. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. Slow Cooker Breakfast Ideas {To Simplify Busy Mornings}. Maple Bacon Muffin Recipe & The Consumable Christmas. March Meal Plan & 7, 30 Minute Tasks for Filling the Freezer. Bacon Wrapped Egg, Spinach & Cheese “Muffins”. Sugar-Free Blueberry Scones #Switch2Swerve.
Recipes Archives - Simplify, Live, Love
http://www.simplifylivelove.com/category/recipes
Simplify, Live, Love. Enjoy simple family living with real food, organic gardening, good fun, and lots of love. Disclosure & Privacy Policy. I’ve been featured…. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. Red & Gold Focaccia Pizza Appetizer or Entree! How to Freeze Carrots & 4 More Ways to Preserve Them. How to Make Whole Wheat Bread with a KitchenAid. 3 Pea Pasta with Bacon, Spinach, & Cheese. My Great-Great Grandma’s From Scratch Strawberry Shortcake Recipe. I'm a...
Family Archives - Simplify, Live, Love
http://www.simplifylivelove.com/category/family
Simplify, Live, Love. Enjoy simple family living with real food, organic gardening, good fun, and lots of love. Disclosure & Privacy Policy. I’ve been featured…. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. We’re Transitioning from Homeschool to Public School. Let the Kids Make their Own Healthy School Lunches! Printable Checklist for a Smooth Back to School Transition. 5 Water Survival Skills your Children Must Know. 100 Summer Boredom Buster Ideas for Kids. Grab som...
Giveaways Archives - Simplify, Live, Love
http://www.simplifylivelove.com/category/giveaways
Simplify, Live, Love. Enjoy simple family living with real food, organic gardening, good fun, and lots of love. Disclosure & Privacy Policy. I’ve been featured…. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. One Pot Chicken, Bacon, & Mushroom Pasta. Dunkin’ Donuts All Day Breakfast Menu & a Giveaway! How to Start Cooking from Scratch with 5 Easy Tips. Mediterranean Tomato Salad #BlakesPairing. Grab some coffee or wine and hang out for a bit! Stalk me on Instagram!
TOTAL PAGES IN THIS WEBSITE
20
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Health post
http://michelleslittlepieceofheaven.blogspot.com/2012/09/health-post.html
Tuesday, September 11, 2012. I will be taking a break from blogging for a few days due to health problems and hospital stay. Please pray for me ,That they find the problem and they can fix it. Thank everyone. Have a great week. September 12, 2012 at 2:53 AM. I am so sorry you are not feeling well. September 12, 2012 at 5:37 AM. Will be praying for you and the dr. September 12, 2012 at 8:06 AM. Lifting you up in my prayers. September 12, 2012 at 10:55 AM. Praying for your recovery. Pioneer Woman at Heart.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Have you ever just been tired ?
http://michelleslittlepieceofheaven.blogspot.com/2015/05/have-you-ever-just-been-done.html
Wednesday, May 20, 2015. Have you ever just been tired? May 21, 2015 at 5:45 AM. There is such a thing as media overload. Im believe it or not distancing myself. It can be very depressing for sure! I watch and read your posts.Im here and will try to comment more to let you know it,.Just in case you forget.Love you Michelle. 3. May 21, 2015 at 5:46 AM. I do believe there is a point of too much social media. I limit myself to my blog - no facebook, twitter, chat rooms etc. May 21, 2015 at 5:51 AM. Are the ...
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Shrimp Pot Sticker
http://michelleslittlepieceofheaven.blogspot.com/2015/05/shrimp-pot-sticker.html
Saturday, May 30, 2015. This is a post I did a while back. Although when I went to look for it ,it had been deleted. Luckily I had saved it on my recipes page. So I am reposting it for myself and for those reading this blog. This is one of my all time favorite recipes. 1 and1/2 pounds of cooked Shrimp or 1 pound of any other cooked meat you may like. 4 chopped green onions. 4 cloves roughly chopped garlic or 1 teaspoon of minced garlic.( Optional). 1 eggs and one egg white. 3 tablespoons of soy sauce.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Tiffany's solo flight
http://michelleslittlepieceofheaven.blogspot.com/2013/04/tiffanys-solo-flight_2.html
Tuesday, April 2, 2013. She is working towards becoming a helicopter pilot for the Fire Department as well as adding a single engine pilot licenes to her belt. They have a tradition of dowsing you with water on your first solo flight. Poor Tiff it was a cold and windy day. But nothing could interfere with how elated she was that day. April 2, 2013 at 4:29 PM. WOW, clapping wildly for Tiffany. Ambitious and talented she is! April 3, 2013 at 3:11 AM. April 3, 2013 at 3:26 AM. April 3, 2013 at 6:26 AM.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Make Your Own Simmering Potpourri
http://michelleslittlepieceofheaven.blogspot.com/2013/12/make-your-own-simmering-potpourri.html
Monday, December 30, 2013. Make Your Own Simmering Potpourri. 2 oranges slice thin and dehydrated. 2 apples sliced thin and dehydrated. 2 jars of Cinnamon sticks ( Note: Use cinnamon sticks from the Hispanic section of the store. It's a lot cheaper. ). 1 jar of bay leaves. 1 jar of whole cloves. 1/2 jar of dried rosemary. Mix items in a bowl ,then place in a plastic bag or air tight container. The house smells so good! Two oranges-sliced and dried. Two apples-sliced and dried. 2 jars of cinnamon sticks.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: family time.
http://michelleslittlepieceofheaven.blogspot.com/p/links.html
My loving husband. After 22 years still treats me like a precious jewel. I think I'll keep him. Melinda my oldest daughter.We are so much a like in some ways and so different in others. Chivon my second child.Kind hearted and stubborn. ( Cleopatches4 ). Tiffany and Trisha, my twins. Picture says it all. These are my Grandchildren ( Mindy's children ). I have wonderful grandchildren. Subscribe to: Posts (Atom). Pioneer Woman at Heart. 20-Min Kickboxing Workout to Punch Monday in Face. MOVING ON TO THE PAST.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Weekend camping trip
http://michelleslittlepieceofheaven.blogspot.com/2015/07/weekend-camping-trip.html
Wednesday, July 22, 2015. July 23, 2015 at 5:11 AM. We have yet to get camping. Its nice to be close enough you can tend to animals. Looks like fun! July 23, 2015 at 6:42 AM. Oh, I loved your video! How fun to go camping and your trailer is gorgeous! You have so much room in there. Our little Kiki is very small. Poor little Cleo so scared of the storm. Glad you got the nice rain and that chicken looks so good! I could close my eyes and think it was her voice! Be a sweetie,. Be a sweetie,. The Southern La...
This Mommy's Meals: Wednesday, October 19, 2011
http://thismommysmeals.blogspot.com/2011/10/wednesday-october-19-2011.html
What One Family Eats. Wednesday, October 19, 2011. Wednesday, October 19, 2011. It was another hectic morning in our house, so the girls had baggies of Honey Kix and I had a baggie of Multigrain Cheerios on the way to carpool. The girlies drank their milk and took their vitamins. Before we left, and I had coffee. The girls had frozen GoGurts for snack and I had a leftover chocolate chip cookie from our big girl's school fair last weekend. We had fried chicken, corn, green beans (with bacon! SkinnyTaste&#...
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: How to kill a Ant Hill .
http://michelleslittlepieceofheaven.blogspot.com/2015/06/how-to-kill-ant-hill.html
Friday, June 26, 2015. How to kill a Ant Hill . June 29, 2015 at 5:37 AM. Good tips and no chemicals to harm the pets! August 23, 2015 at 3:36 PM. I must try this because we have ants in our house they just wont leave and no amount of spraying works.gonna try glad you had this on here! Subscribe to: Post Comments (Atom). Pioneer Woman at Heart. 20-Min Kickboxing Workout to Punch Monday in Face. Mennonite Girls Can Cook. Quick Shake Fruit Cobbler. Salsa Time. Rhubarb Salsa. What the week holds, and game on.
michelleslittlepieceofheaven.blogspot.com
Michelle's Little Piece Of Heaven: Making Tomato Powder
http://michelleslittlepieceofheaven.blogspot.com/2015/06/making-tomato-powder.html
Monday, June 15, 2015. Tomato powder is very easy to make. You can us your own canned tomatoes .Fresh or store canned tomatoes work just as well. If your using fresh tomatoes just cut them thin and place in a single layer in your food dehydrate . For canned tomatoes place in a blender or food processor and blend. After cooled and crumbled, place in a coffee grounder or some type of blender. Blend till you have a nice powder. I place my power in a Ziploc bag with a oxygen absorber. June 16, 2015 at 4:38 AM.
TOTAL LINKS TO THIS WEBSITE
215
Fashionable Canes, Walker Basket
A wealth of information and advice . TAX FREE on most items,. Away From Home Health Care. MEDICARE, Advocacy and Answers. Latest News on Medicare. For the bathroom or a yoga mat to enhance your exercise regimen, our website is full of useful and practical possibilities. Away From Home Health Care. Mobility is something that can be particularly difficult for aging adults or the disabled, which is why we feature many different options for mobility aids. You can find a.
Simplify Life With Mrs R - Inspiration and Support for Midlife Women. Be Healthier, Be Happier, Reinvent!
January 10, 2017. Ageism In The Workplace, Are You Really Prepared? By: Mrs. R. January 5, 2017. A Fresh Basil Pesto You Must Try! By: Mrs. R. January 5, 2017. Daikon Noodle Soup with Mushrooms & Onion. Did you do a bit of over-indulging this holiday season? I know I did! By: Mrs. R. January 3, 2017. Are You Aging Healthfully? Helpful Tips To A Better Life. By: Mrs. R. December 14, 2016. Tuscan Bean Dip with Pita Chips. By: Mrs. R. December 13, 2016. By: Mrs. R. December 12, 2016. It’s also a time ...
simplifylifewithmrsr.mealplannerpro.com
Meal Planner Pro | Your Free Meal Planning Solution
Save Time. Save Money. Eat Healthy! Online meal planning solution. Click Here to Get Started! Free Shopping List Apps Now Available! Meal Planner Pro will help you to save time and money while improving your health in just a few easy steps. Create a profile for each family member. Unlock personalized meal planning tools and features based on your individual and family health goals. Search, Save and Add Your Own Recipes. Add Saved Recipes to the meal planning calendar. Create a Meal Plan.
Web Hosting, Reseller Hosting & Domain Names from Heart Internet
This domain has been registered by Heart Internet if you are the owner of this domain please login. Unlimited web hosting packed full of great hosting features, from only £2.49 per month. Find out more about our unlimited web hosting. Make money selling unlimited websites, domain names and more with our white label reseller hosting package. Great value domain names from only £2.79 per year. Already have a domain? Transfer in your domain for free. The UK's Best Reseller Package. Own Branded Control Panel.
Simplify, Live, Love
This page has moved to a new address. Simplify, Live, Love.
Simplify, Live, Love - {A simple, green, homeschooling family of six learning to thrive with less on a modern-day Iowa homestead.}
Simplify, Live, Love. A simple, green, homeschooling family of six learning to thrive with less on a modern-day Iowa homestead.}. Top 10 Tips for Saving Money. Birth & Death. Frugal & Green. Giveaways & Reviews. Tuesday Garden Party Garden Inspiration for 8/11/2015. August 11, 2015. If you're new here, you may want to subscribe to my RSS feed. Filed Under: Tuesday Garden Party. Easy Oven Sandwich Recipe – Perfect for Freezer Cooking. August 10, 2015. This feature has been compensated by ALDI. They’...
SIMPLIFY LLC
Wednesday, February 11, 2015. Let Love Warm Up your Winter! Here we are with just a few days left until Valentine’s Day! The weather outside continues to be frightful…makes me wonder…how will you warm your heart? While fancy dinners out with your honey can be very tasty and romantic…the bill may leave you feeling cold! Can’t get a babysitter, anyway? Stay home with all your little Valentines and eat a backwards dinner…chocolate first! Remember, it doesn’t all have to be about hearts and romance. Books fo...
Simplify | Modernizing the Alternative Investment Ecosystem
Modernizing the Alternative Investment Ecosystem. The alternative investment world is no longer fragmented, secretive, or illiquid. Signup for the Beta. Our Latest Hedge Fund Research. Report Now Available For Purchase. Simplify delivers a tightly integrated portfolio management experience with normalized industry data. Designed for Pensions, Endowments, Family Offices and Sophisticated Investors worldwide. We provide the most complete range of private and public liquid alternatives funds. The institutio...
Simplify Lifestyle Management | What is your time worth?
Your life could be easier. You’re busy. Your to-do list is a mile long and you’re overwhelmed. Or you simply prefer to spend your evenings and weekends relaxing, rather than running errands or worrying about who to call to fix that leaky sink. Relax… help has arrived. Focus on what you really enjoy. We’ll handle the rest. Your home should feel comfortable and serve as a place of rest and relaxation. When you are ready to move, we can help! We will organize and pack your entire relocation. We can solve it.
Simplify LMS - Best cloud Learning Management System
Simplify LMS - Best cloud Learning Management System. Simplify LMS is the best cloud-based learning management system for small to medium businesses. 30 Day Guarantee. Free Demo. From $1.80/user/month. Sydney, Australia. Https:/ res.cloudinary.com/hrscywv4p/image/upload/c limit,h 630,q 90,w 1200/v1/807961/Simplify LMS - basic image of text gcoxlr.png. More than just a Learning Management System. It's a comprehensive, cloud-based solution to help your business run better. Founder - Northstar Martial Arts.
SOCIAL ENGAGEMENT