slightlypeckish.co.uk
Slightly PeckishFood, recipes, cooking, travel and reviews of restaurants, cafés and bars in London and elsewhere.
http://slightlypeckish.co.uk/
Food, recipes, cooking, travel and reviews of restaurants, cafés and bars in London and elsewhere.
http://slightlypeckish.co.uk/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
0.5 seconds
16x16
32x32
PAGES IN
THIS WEBSITE
19
SSL
EXTERNAL LINKS
19
SITE IP
172.217.7.147
LOAD TIME
0.5 sec
SCORE
6.2
Slightly Peckish | slightlypeckish.co.uk Reviews
https://slightlypeckish.co.uk
Food, recipes, cooking, travel and reviews of restaurants, cafés and bars in London and elsewhere.
slightlypeckish.co.uk
Slightly Peckish: C Cooks: Baked Camembert with Homemade Garlic Bread
http://www.slightlypeckish.co.uk/2012/10/c-cooks-baked-camembert-with-homemade.html
Tuesday, 23 October 2012. C Cooks: Baked Camembert with Homemade Garlic Bread. Baked camembert - is there actually anything more enjoyable to eat? C has spent some time pondering this question (yes, really) and can only come up with a handful of things she likes as much as this. For the uninitiated, camembert is wonderfully gooey, soft, runny cheese which is just perfect. A slice of heaven? Now is the time to drizzle olive oil over the cheese too (C refrained from this level of decadence this time though!
Slightly Peckish: A London Secret: Chinatown's Bao stalls
http://www.slightlypeckish.co.uk/2012/11/a-london-secret-chinatowns-bao-stalls.html
Wednesday, 7 November 2012. A London Secret: Chinatown's Bao stalls. The only shame about these places is that they are not open super late. You have to get them as an early supper or a lunch, rather than as a midnight snack on your way out of the clubs. That's OK though, if you're hell-bent on a massive bender on Leicester Square, you can have these before to soak up the booze! Subscribe to: Post Comments (Atom). Two Food Fans Eat, Drink and Blog Their Way Around The World. Eating Around The World.
Slightly Peckish: Happiness Forgets
http://www.slightlypeckish.co.uk/2012/11/happiness-forgets.html
Wednesday, 21 November 2012. It's not often that we write about drinking spots on this blog, but we had to make an exception for Hoxton bar Happiness Forgets. While we're primarily foodies and not the biggest boozers (A, in particular, titles himself The Last Of The Great Drinkers), we're not averse to a few drinks either side of a meal out. The menu - affordable and. What makes Happiness Forgets so good? Secondly, the cocktails at Happiness Forgets are good. Thirdly, the prices: each cocktail is around ...
Slightly Peckish: A & C Cook: Yorkshire Puddings
http://www.slightlypeckish.co.uk/2013/01/a-c-cook-yorkshire-puddings.html
Friday, 11 January 2013. A and C Cook: Yorkshire Puddings. Yorkshire puddings are one of C's all-time favourite foods - it's the stodgy and crispy, yet soft and light, consistency that really appeals to her. For the uninitiated, Yorkshire puddings. While we'd like to suggest that our success was due to our cooking abilities, we're willing to concede that it was probably the recipe that made all the difference: we used the ever-reliable Delia Smith. 3 fl oz/75ml milk. 2 fl oz/50ml water. 2 tablespoons bee...
Slightly Peckish: A Wander Down the Pho Mile
http://www.slightlypeckish.co.uk/2012/09/a-wander-down-pho-mile.html
Monday, 10 September 2012. A Wander Down the Pho Mile. C tweeted A a couple of days ago, asking if he wanted to check out a night time street market. The place we picked, Mien Tay. Extremely Crispy Spring Rolls. Chicken with Honey and Spices, without the Spices. Yummy Pho with herbs on the side. The drinks were also above par and C was enthusing about her lemonade. It appears to be home made, and is sweet, lemony and very refreshing; in other words, perfect for a muggy summer evening. The Duck and Waffle.
TOTAL PAGES IN THIS WEBSITE
19
manchesterfoodies.blogspot.com
Manchester Foodies: December 2013
http://manchesterfoodies.blogspot.com/2013_12_01_archive.html
Monday, 30 December 2013. Recipe: Perfect Fried Chicken. Making fried chicken should. Be a simple activity: take jointed chicken, dip in some kind of binding agent (milk, buttermilk, egg or plain water), dredge in seasoned flour, then fry in fat. But, in the pursuit of an idealised version, there are always plenty of other questions vying for attention. To brine or not to brine? Skin on or skin off? Which flour or flours? Will plain flour suffice or should you reach for more advanced starches? Is good...
manchesterfoodies.blogspot.com
Manchester Foodies: Recipe: The Manchester Foodies' Big Mac
http://manchesterfoodies.blogspot.com/2014/04/recipes-manchester-foodies-big-mac.html
Monday, 28 April 2014. Recipe: The Manchester Foodies' Big Mac. They don't look that pretty, but they taste damn good. At work the other day, I found myself listening to the dulcet tones of Aaron Lewis, morosely intoning Staind's “smash” hit It's Been Awhile. And I thought: yes it has Aaron, yes it has. But here I am. Writing once again. Wax on, as it were. So, let’s get back to the task in hand. Here) I wanted to go a bit further. As always my research started with Serious Eats, Modernist Cuisine and He...
manchesterfoodies.blogspot.com
Manchester Foodies: Tickets, Barcelona
http://manchesterfoodies.blogspot.com/2014/06/tickets-barcelona.html
Sunday, 29 June 2014. Eaten there - without, of course, the pain of shelling out a couple of hundred euros in cash. But everyone said, "Go! Cue charming waiter, who delivered the best service we've experienced at a restaurant, and a suggestion he could bag us a table for a couple of night's time. Well, it sort of felt rude to turn down such an offer. And, we found, it had. More or less. The food - for the most part - was pretty perfect. Spherified olives with a skin you could barely. There were the Manch...
manchesterfoodies.blogspot.com
Manchester Foodies: Top Ten Cheap Eats in Manchester
http://manchesterfoodies.blogspot.com/2013/01/top-ten-cheap-eats-in-manchester.html
Wednesday, 9 January 2013. Top Ten Cheap Eats in Manchester. Need I bother with an intro? 1 Yuzu, 39 Faulkner street, China Town. 2 Al Jazeera, 22 Wilmslow road, Rusholme. But it's worth a trip for the kobeda kebab alone. 3 Frankie's Fish Bar, 178 Burton Road, West Didsbury. NOTE: This place has now been overtaken by 'Fishbait'. I'm yet to try their deep fried delights! Fried food (I do try, but at 5'11 it's hard to store them out of his reach). 4 Kyotoya, 28 Copson Street, Withington. A mere £7. Seoul K...
manchesterfoodies.blogspot.com
Manchester Foodies: 5 Cheap Eats in el Born, Barcelona
http://manchesterfoodies.blogspot.com/2014/07/5-cheap-eats-in-el-born-barcelona.html
Saturday, 19 July 2014. 5 Cheap Eats in el Born, Barcelona. Possibly my favourite 'cheap eat' in Barcelona - we've visited La Paradeta the last two times we've visited the city. On entering, you're encountered with a massive fresh fish counter - think monkfish, lobster, sea snails, oysters, mussels, razor clams, tuna, salmon. there's pretty much everything a fish lover could dream of here. It looks busier - and scarier! Carrer Comercial, 7. Check out our pals, Arepa! Fortunately, there's also "La Mixta",...
manchesterfoodies.blogspot.com
Manchester Foodies: July 2014
http://manchesterfoodies.blogspot.com/2014_07_01_archive.html
Saturday, 19 July 2014. 5 Cheap Eats in el Born, Barcelona. Possibly my favourite 'cheap eat' in Barcelona - we've visited La Paradeta the last two times we've visited the city. On entering, you're encountered with a massive fresh fish counter - think monkfish, lobster, sea snails, oysters, mussels, razor clams, tuna, salmon. there's pretty much everything a fish lover could dream of here. It looks busier - and scarier! Carrer Comercial, 7. Check out our pals, Arepa! Fortunately, there's also "La Mixta",...
manchesterfoodies.blogspot.com
Manchester Foodies: Nick Griffin: A Far-right Foodie
http://manchesterfoodies.blogspot.com/2014/01/nick-griffin-far-right-foodie.html
Saturday, 25 January 2014. Nick Griffin: A Far-right Foodie. An overlooked culinary genius? As a food blogger, I feel it's my job to like food. And I do. But I'm not sure I'd claim that food is an effective cure for the side effects of bad government. Yet that is precisely what bankrupt BNP leader Nick Griffin does in a video cunningly entitled Recipe for beating the Tory blues. So what’s in this dish, apart from diluted anti-Tory sentiment? Maybe because the Mexican population in Britian is miniscule.
manchesterfoodies.blogspot.com
Manchester Foodies: January 2014
http://manchesterfoodies.blogspot.com/2014_01_01_archive.html
Saturday, 25 January 2014. Nick Griffin: A Far-right Foodie. An overlooked culinary genius? As a food blogger, I feel it's my job to like food. And I do. But I'm not sure I'd claim that food is an effective cure for the side effects of bad government. Yet that is precisely what bankrupt BNP leader Nick Griffin does in a video cunningly entitled Recipe for beating the Tory blues. So what’s in this dish, apart from diluted anti-Tory sentiment? Maybe because the Mexican population in Britian is miniscule.
manchesterfoodies.blogspot.com
Manchester Foodies: Drunken Butcher: goes posh with Sous Vide
http://manchesterfoodies.blogspot.com/2014/01/drunken-butcher-goes-posh-with-sous-vide.html
Saturday, 18 January 2014. Drunken Butcher: goes posh with Sous Vide. Duck breast, confit duck leg, mash and cavolo nero. Whilst Iain Devine, aka Drunken Butcher. Is well-known for his mammoth supper club feasts, encouraging a family style sharing of dinner, he's perhaps less known for 'poncy food'. Just because he doesn't often showcase it though, doesn't mean he isn't a dab hand at it. As ever, all of the dishes were cooked beautifully, and Iain even managed to prove to us all that he can do poncey!
manchesterfoodies.blogspot.com
Manchester Foodies: November 2013
http://manchesterfoodies.blogspot.com/2013_11_01_archive.html
Thursday, 28 November 2013. I'm pretty sure we all know SoLIta by now. So I'll skip the preamble and get down to it. We were invited by Franco Sotgiu ostensibly to try out the new chicken wings menu. And as such were not asked to pay for any of the below. Let's talk about the good things first. I'd say, without exaggeration, that somewhere in my hypothetical last meal there would be some variation on deep-fried chicken wings. You get the picture. Ain't no thing but a PB and J chicken wing. Be cooked corr...
TOTAL LINKS TO THIS WEBSITE
19
Web Hosting, Reseller Hosting & Domain Names from Heart Internet
This domain has been registered by Heart Internet if you are the owner of this domain please login. Unlimited web hosting packed full of great hosting features, from only £2.49 per month. Find out more about our unlimited web hosting. Make money selling unlimited websites, domain names and more with our white label reseller hosting package. Great value domain names from only £2.79 per year. Already have a domain? Transfer in your domain for free. The UK's Best Reseller Package. Own Branded Control Panel.
Mind Your Own Business, Kid (TM) - First Class Support for Next Generation Entrepreneurs
Mind Your Own Business Kid. Teen CEO Club.com. Alexandria, VA 22308. Already Have a Business? Choose this course instead and compete in our Business Accelerator Challenge. MIND YOUR OWN BUSINESS ,. In this FREE online training program that you will have access to begi nning Jan. 7th 2015. You can do the following:. Find business ideas and products that fit with your interests and skills. Learn how to get started with your chosen bu. Use technology to build your business quickly. You'll learn how to take ...
slightlyoverweighthousewives.com
My Site
This is my site description. Powered by InstantPage® from GoDaddy.com. Want one?
Default Web Site Page
If you are the owner of this website, please contact your hosting provider: webmaster@slightlyparanoid.com. It is possible you have reached this page because:. The IP address has changed. The IP address for this domain may have changed recently. Check your DNS settings to verify that the domain is set up correctly. It may take 8-24 hours for DNS changes to propagate. It may be possible to restore access to this site by following these instructions. For clearing your dns cache.
slightlypearshaped
Creative Commons Attribution-NonCommercial-ShareAlike 3.0 Unported License, unless stated otherwise.
Slightly Peckish
Monday, 4 May 2015. Banh Xeo: Vietnamese Pancakes. We fell in love with Vietnamese food when we were travelling through the country. Food is, of course, always one of our favourite things about travelling anywhere, but of all the places we've been we'd say Vietnam ranks one of the highest for its food (forming a nice top three with, we'd probably say, India and Italy). We have done a few brilliant cookery courses around the world, but we have to say that the one we did on Thuan Tinh Island. Once it's all...
My Site
This is my site description. Powered by InstantPage® from GoDaddy.com. Want one?
Web hosting, domain name registration and web services by 1&1 Internet
THIS DOMAIN NAME HAS JUST BEEN REGISTERED FOR ONE OF OUR CUSTOMERS! Do you need affordable web hosting or a domain name? 1&1 Internet is trusted by millions. Find out why. Offers a one-stop shop for all your domain name and web hosting needs so you can maximize your full web potential — without barriers, and without fear. Smart webmasters choose 1&1 Internet for domain name registration and hosting solutions. All-Inclusive Hosting Plans with NO Hidden Charges. 24/7 Phone and E-mail Support.
Slightly Perfect boutique
Welcome to Slightly Perfect Boutique information page. Details on our range of products are now loading. For more or similar products click on the links below. Thank you. If this site has not loaded shortly you require a Flash Pluging, this can be quickly downloaded here. Go directly to: Accessories,.
slightlyperfectslightlyimperfect.wordpress.com
slightlyperfectslightlyimperfect | Just another WordPress.com site
Get me outta here! Just another WordPress.com site. July 9, 2015. Blogging has never been a continuos part of my life. I have started and ended this hobby a number of times. Oh! Blame it on my Gemini traits. It is quite wonderful to blame something else for all the wrong you do. Bad habit but you have to get through life right? Follow Blog via Email. Enter your email address to follow this blog and receive notifications of new posts by email. Join 21 other followers. Top Posts and Pages.
slightlyperiwinkle.blogspot.com
periwinkle conundrum
Lift up your hearts! View my complete profile. A heavy and joyful heart have I. Sunday, July 10, 2011. A heavy and joyful heart have I. It seems that I have been receiving blow upon blow lately. News from my family. Striking me right in the gut. I cried for an entire hour one night. Held tight, wrapped in loving arms, but still sad nonetheless. Of course as people get older, life becomes harder. I realized that I feel the pain of my family more than anything else. I weep for them. WHY IS LIFE SO PAINFUL?
SOCIAL ENGAGEMENT