srisubrahmanyadevalayam.com srisubrahmanyadevalayam.com

SRISUBRAHMANYADEVALAYAM.COM

Sri Subrahmanya Devalayam

www.catchway.com

http://www.srisubrahmanyadevalayam.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR SRISUBRAHMANYADEVALAYAM.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

November

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Saturday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 5.0 out of 5 with 1 reviews
5 star
1
4 star
0
3 star
0
2 star
0
1 star
0

Hey there! Start your review of srisubrahmanyadevalayam.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

0.3 seconds

CONTACTS AT SRISUBRAHMANYADEVALAYAM.COM

CATCHWAY TECHNOLOGIES

CATCHWAY TECHNOLOGIES

50-●●●0/c

visa●●●●tnam , Andhra Pradesh, 530016

INDIA

9199●●●●7233
te●●@myownwebsite.in

View this contact

CATCHWAY TECHNOLOGIES

CATCHWAY TECHNOLOGIES

50-●●●0/c

visa●●●●tnam , Andhra Pradesh, 530016

INDIA

9199●●●●7233
te●●@myownwebsite.in

View this contact

CATCHWAY TECHNOLOGIES

CATCHWAY TECHNOLOGIES

50-●●●0/c

visa●●●●tnam , Andhra Pradesh, 530016

INDIA

9199●●●●7233
te●●@myownwebsite.in

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
2011 December 02
UPDATED
2013 November 28
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

DOMAIN AGE

  • 13

    YEARS

  • 10

    MONTHS

  • 21

    DAYS

NAME SERVERS

1
ns1701.websitewelcome.com
2
ns1702.websitewelcome.com

REGISTRAR

PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM

PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM

WHOIS : whois.PublicDomainRegistry.com

REFERRED : http://www.PublicDomainRegistry.com

CONTENT

SCORE

6.2

PAGE TITLE
Sri Subrahmanya Devalayam | srisubrahmanyadevalayam.com Reviews
<META>
DESCRIPTION
www.catchway.com
<META>
KEYWORDS
1 www.catchway.com
2
3 coupons
4 reviews
5 scam
6 fraud
7 hoax
8 genuine
9 deals
10 traffic
CONTENT
Page content here
KEYWORDS ON
PAGE
temple timings,website maintained by,drakondi butchi raju,mpharm phd,powered by,catchway technologies
SERVER
nginx/1.8.0
CONTENT-TYPE
iso-8859-1
GOOGLE PREVIEW

Sri Subrahmanya Devalayam | srisubrahmanyadevalayam.com Reviews

https://srisubrahmanyadevalayam.com

www.catchway.com

INTERNAL PAGES

srisubrahmanyadevalayam.com srisubrahmanyadevalayam.com
1

Sri Subrahmanya Devalayam

http://www.srisubrahmanyadevalayam.com/festivals.html

On Masasivarathri day of Every Month Abhishekam and other special poojas are conducted. On Sasthi Thidi of every month special poojas are conducted. On every Monday and Tuesdays:. Pooja for Naga Dosha Nivarana is conducted. Rudrabishekam and Laksha Pathri Pooja are conducted by the Priests. On this auspicious occasion Poojas are conducted for "Suryanarayana". Abhishekam for Sani Bhagavan. Poojas are conducted for 9 Days. Note: Accommodation available on prior intimation and registration.

2

Sri Subrahmanya Devalayam

http://www.srisubrahmanyadevalayam.com/history.html

Strange are the ways of the divine that a mystery seldom remains beyond comprehension. A unique phenomenon occurred in the eastern outskirts of the village Alavelli Mallavaram, Gollaprolu Mandalam, East Godavari District in 1961.A cobra really divine in nature appeared in the temple land of lord kukkuteswara of Pithapuram, without touching anything or go away anywhere in spite of the provocations by the visitors, about a week after subrahmanya shashti. Construction of the temple was completed as per "Aga...

3

Sri Subrahmanya Devalayam

http://www.srisubrahmanyadevalayam.com/offerings.html

Your contribution is highly appreciated. For more information contact Temple Committee. For yearly Pooja: Please send Rs 500/-Demand Draft in the name of Sri Subrahmanya Devalayam payble at Canara Bank, A.V. Nagaram. Abhishekam will be conducted on a day of your choice in a year and Prasadam will be sent to you by post. Cash donations are accepted and acknowledged at the Temple office. Annadana Padhakam: Distribution of meals in "Sasthi Celebrations". Please contact temple authorities.

4

Sri Subrahmanya Devalayam

http://www.srisubrahmanyadevalayam.com/committee.html

Members of the Alaya Committee. Sri Kadimisetti Kumara Bhaskara Reddy. Sri Athkuri Nageswara Rao. Sri Rayavarapu Adinarayana Rao. Sri kadimisetti Venkat rao. Sri Kadimisetti Vijaya Bhaskara Reddy. Sri Arigela Ramayya Dora.

5

Sri Subrahmanya Devalayam

http://www.srisubrahmanyadevalayam.com/index.html

Slokam: ELA PAMPABDHI SAMYOGE SRI CHATHURVEDI MANGALE. SUBRAHMANYESWARA SSAKSHADUDBHUTHA PLAVA VATHSARE. Morning: 6.00 am to 12.00 am. Evening : 4.30 pm to 8.00 pm. The temple timings are extended on all festival days. During Karthika Masam the temple opens at 04.30 am The timings are subject to changes on the days of solar / lunar eclipses and also under certain unavoidable circumstances.

UPGRADE TO PREMIUM TO VIEW 0 MORE

TOTAL PAGES IN THIS WEBSITE

5

OTHER SITES

srisubhammatrimony.com srisubhammatrimony.com

Sri Subham Matrimony.com

Profile ID Search ». Quick Register ».

srisubhodayaestates.blogspot.com srisubhodayaestates.blogspot.com

Sri Subhodaya Estates

Hello Sir/Madam, This is Giri, from Guntur. Than. View my complete profile. Sunday, December 21, 2008. This is Giri, from Guntur. Thank you very much for your response to my Ad. The name of our Company is " SRI SUBHODAYA ESTATES ". Our Company had completed 2 Years in Real Estate Business and is running. In the 3rd Year successfully. This year we are glad to inform you thatwe are also entering into Construction. Feild We are starting Group Housing in our ventures. 1) Grandhi. Chandra Mouleswara Rao,.

srisubhodayaestatesguntur.com srisubhodayaestatesguntur.com

:: Welcome to Sri Subhodaya Estatse ::

Welcome to Sri Subhodaya Estatse.

srisubhuthi.sch.lk srisubhuthi.sch.lk

Sri Subhthi National School - Official Web Site

Welcome : : :. In an era where information technology has become an integral part in all aspects of our lives, it is my great pleasure to introduce the official website of Sri Subhuthi National School, which will be our electronic portal to the e-world. Eve the launch of this website is of great importance to our school and our children as we are marching ahead in our. Sri Subhuthi National School, Battaramulla, Sri Lanka.

srisubikshambuilders.com srisubikshambuilders.com

:: Sri Subiksham Builders :::

A JOURNEY TO SWEET HOME. M/s Sri Subiksham Builders is a partnership concern, which is commenced during 2002 and at present registered in the name and style of Sri Subiksham Builders Private Limited and each with its own character in terms of real estate, design, architecture, interiors and facilities management, serving the needs of a discerning clientele. Object of the firm is to promote, develop and Build good quality residential houses/ flats at competitive rates.

srisubrahmanyadevalayam.com srisubrahmanyadevalayam.com

Sri Subrahmanya Devalayam

Slokam: ELA PAMPABDHI SAMYOGE SRI CHATHURVEDI MANGALE. SUBRAHMANYESWARA SSAKSHADUDBHUTHA PLAVA VATHSARE. Morning: 6.00 am to 12.00 am. Evening : 4.30 pm to 8.00 pm. The temple timings are extended on all festival days. During Karthika Masam the temple opens at 04.30 am The timings are subject to changes on the days of solar / lunar eclipses and also under certain unavoidable circumstances.

srisubrahmanyaswamydevalayamskandagiri.org srisubrahmanyaswamydevalayamskandagiri.org

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

Welcome to the official website of. Skandagiri, Kamakotinagar, Padmarao Nagar, Secunderabad 500061.

srisubramaniarlokkawi.org srisubramaniarlokkawi.org

Home

Home ம கப ப. Temple History க ய ல வரல ற. Introduction to temple க வ ல அற ம கம. Executive Committee ந ர வ க க ழ. Temple Deities க வ ல த ய வங கள. Services ச வ கள. Pooja Services ப ஜ ச வ கள. Events Calendar ந கழ வ கள க லண டர. Volunteer த ண டர கள. Donation நன க ட கள. Our Location எங கள ம கவர. Feedback உங கள கர த த. Current temple building was built in 90’s. Read more: Sri Subramaniar Temple. Read more: Temple History. Hinduism, also known as the Sanatana Dharma, or "Eternal Way," is our planet's original and...

srisubuindustries.com srisubuindustries.com

srisubuindustries,srisubuindustries.com

We are Sri Subu Industries, a reputed and leading manufacturers of products as Soap Stamping Machine, Detergent Cake Cutting Machines, Washing Powder Mixing Machines, Detergent Soap Mixer Machines, Detergent Soap Plodder Machines, Machine, Detergent Powder Mixer Machines, Plodder and Toilet Shop Machine. Services Enquiry Contact Us. Best viewed @ 1024x768 resolution and higher.

srisud.wordpress.com srisud.wordpress.com

srisud | Just another WordPress.com site

Just another WordPress.com site. Mengaplikasikan Administrasi Perkantoran di Tempat Kerja. November 18, 2010. TATA PERSURATAN DAN KEARSIPAN. Tata Persuratan (Mail Handling). Prosedur penanganan surat baik surat masuk maupun surat keluar dapat dilakukan dengan dua sistem yaitu Sistem Buku Agenda dan Sistem Kartu kendali. Karakteristik mail handling sistem buku agenda adalah saat penanganan dan pendistribusian surat diperlukan buku-buku sebagai berikut :. Buku Agenda Surat Masuk. Buku Agenda Surat Keluar.

srisuda.com srisuda.com

STRATO