stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown DailyMarketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.
http://www.stephaniefiermanmarketingdaily.com/
Marketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.
http://www.stephaniefiermanmarketingdaily.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Friday
LOAD TIME
2.2 seconds
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
Stephanie Fierman
7 Castl●●●●●●●e Drive
East●●●●over , New Jersey, 07006
United States
View this contact
BUY YOUR DOMAIN
16
YEARS
2
MONTHS
10
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
24
SITE IP
68.178.254.126
LOAD TIME
2.209 sec
SCORE
6.2
Stephanie Fierman - Marketing Observations Grown Daily | stephaniefiermanmarketingdaily.com Reviews
https://stephaniefiermanmarketingdaily.com
Marketing guru Stephanie Fierman blogs about the art and science of connecting with consumers.
stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/gm-ad-texting-while-driving-stephanie-fierman.php
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Any is too many, Chevrolet. Tuesday April 14th 2015, 10:59 am. If you’d asked me if I could be surprised by any dumb decisions made by GM in the last few years (aside from borrowing money from taxpayers), I’d have said no… ’til now. The perils of texting while driving (TWD) are widely known. In the U.S. alone, TWD creates a crash risk 23 times. So I suppose Chevrolet decided. If you cannot view the ad below, see it HERE.
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/delta-road-warrior-ad-stephanie-fierman.php
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Don’t be afraid to be young and free. Monday March 16th 2015, 11:23 am. I am so happy to be starting the week talking about an ad I genuinely like! 8220; Delta: On the Road. 8221; is a new commercial from Wieden Kennedy that I think absolutely nails it. And takes risks while doing so. Here it is. 8220; Love You. 8221; by The Free Design. Give a little time for the child within you. Don’t be afraid to be young and free.
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/dissheveled-men-shouldnt-sell-me-stuff-stephanie-fierman.php
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Eat a sandwich, get a shave and come back to me. Thursday May 29th 2014, 2:28 pm. Filed under: ad agency. There are two tv ads running right now with male leads exhibiting some weird hygiene and grooming choices. I find it distracting and sort of… weird. First up is an ad for the Lincoln MKZ. What’s up with this dude? Is his stubble meant to look hip? Are we going for hipster here? Because all I get is kind of grody. Click ...
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/2014-stephanie-fierman.php
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. And on to a new year. Tuesday December 31st 2013, 4:19 pm. Filed under: stephanie fierman. So I was in a hospital yesterday with my mom (because holidays and hospitals: that’s just how I roll) and I thought one of her doctors was cute. I was trying to be entertaining, so I said to my mom, “Hey, who knows? Maybe I’ll make my dead grandmothers happy, and still end up with a rich DOC-tuh! Well played, grandmothers, well played.
Stephanie Fierman - Marketing Observations Grown Daily
http://www.stephaniefiermanmarketingdaily.com/category/advertising
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Any is too many, Chevrolet. Tuesday April 14th 2015, 10:59 am. If you’d asked me if I could be surprised by any dumb decisions made by GM in the last few years (aside from borrowing money from taxpayers), I’d have said no… ’til now. The perils of texting while driving (TWD) are widely known. In the U.S. alone, TWD creates a crash risk 23 times. So I suppose Chevrolet decided. If you cannot view the ad below, see it HERE.
TOTAL PAGES IN THIS WEBSITE
20
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/recession
Building successful businesses and brands – one customer interaction at a time. Ever Wish It Was Christmas Every Day Of The Year? December 2nd, 2013. If you’re not careful, you may get your wish. Readers know that I’m partial to a couple cartoonists and like to share their work now and then. On my second blog, it’s David Jones‘ Adland. Here, it’s Tom Fishburne’s Marketoonist. Posted by Stephanie Fierman. Stretching More Than Dollars. October 1st, 2010. No time to sit down for breakfast? Because raw would...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/brand
Building successful businesses and brands – one customer interaction at a time. The Experience Is The Thing. December 4th, 2015. And now a rant on customer experience triggered by Brian Solis. 8216; new book. X: The Experience When Business Meets Design. More on this later). I am a Birchbox. 8221; Twice that day, I took a moment away from my work and clicked through from those emails only to find the product unavailable. Frustrating. As a result, I tweeted. Like all brands, Birchbox’s product is no...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/advertising
Building successful businesses and brands – one customer interaction at a time. Ever Wish It Was Christmas Every Day Of The Year? December 2nd, 2013. If you’re not careful, you may get your wish. Readers know that I’m partial to a couple cartoonists and like to share their work now and then. On my second blog, it’s David Jones‘ Adland. Here, it’s Tom Fishburne’s Marketoonist. Posted by Stephanie Fierman. Where The Wild Things Are In Marketing. May 14th, 2012. Here, it’s Tom Fishburne. October 25th, 2011.
considerthelobster.blogspot.com
Consider the Lobster Blog - Considerez l'Homard avec Liz Keller
http://considerthelobster.blogspot.com/2007_04_01_archive.html
Wednesday, April 18, 2007. My Big Irish Update. So far, so good, people. This place is greener, the Guinness fresher, and Steve more nauseatingly perfect for me than I could possibly have hoped for. For the first ten days of my trip, Steve took off work, so we puttered around together and had the first trial of our previously Skype-based relationship: could we stand each other 24-7 or would I be paying an unscheduled visit to my London friends to get the hell out of here? Posted by Liz at 10:03 AM. My sc...
considerthelobster.blogspot.com
Consider the Lobster Blog - Considerez l'Homard avec Liz Keller
http://considerthelobster.blogspot.com/2006_11_01_archive.html
Wednesday, November 29, 2006. And it feels so . . . meh. I had my ten year high school reunion in San Francisco this weekend, which culminated my Big California Week. I got to SF on a Sunday evening and proceeded to the Hertz rental car area. The woman behind the counter seemed baffled by the fact that I was a woman, alone, renting a car, not for business, not for my boyfriend, but for me and only me to drive. You here on business? You drive for you to go to work? No, like I said, I’m on vacation. The co...
considerthelobster.blogspot.com
Consider the Lobster Blog - Considerez l'Homard avec Liz Keller
http://considerthelobster.blogspot.com/2007_07_01_archive.html
Monday, July 02, 2007. Pride (In the Name of Love). Like all SEOs, and most bloggers, I check stats on my blog to see how many hits I get a day, and how people are finding me. It's usually pretty standard stuff; my name, my blog's name, my name SEO, my name Brooklyn or New York. Generally, nothing comes as much of a surprise. Thanks to this post. I now come up #1 on Google searches for 'conch penis.'. Posted by Liz at 1:07 PM. London, United Kingdom. View my complete profile. A Very Bad Beginning.
considerthelobster.blogspot.com
Consider the Lobster Blog - Considerez l'Homard avec Liz Keller
http://considerthelobster.blogspot.com/2007_02_01_archive.html
Tuesday, February 13, 2007. A saccharine thought from a non-saccharine person. When things are good, take the time to enjoy them. I spend far too much time feeling snarky. It is important to remind myself I should hold on to good memories as tightly as I clutch the bad ones. Even though a friend told me I looked like I got dressed in the dark this morning. Posted by Liz at 10:10 PM. Tuesday, February 06, 2007. Take him home and have your way with him, of course! Pity there's an ocean in the way.
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/marketing-to-women
Building successful businesses and brands – one customer interaction at a time. Ever Wish It Was Christmas Every Day Of The Year? December 2nd, 2013. If you’re not careful, you may get your wish. Readers know that I’m partial to a couple cartoonists and like to share their work now and then. On my second blog, it’s David Jones‘ Adland. Here, it’s Tom Fishburne’s Marketoonist. Posted by Stephanie Fierman. CTPB, The Customer Is Not Always Right. July 25th, 2011. Stores opened in 1992 and, today, she has 15...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/us-economy
Building successful businesses and brands – one customer interaction at a time. Forgive Me Father, For I Have… Showroomed. February 20th, 2014. Pardon my French, but I feel like a total and utter s* t. At least I’ll be punished by having to walk on the other side of the street every time I want to go to the drug store. Allow me to explain. 8221; horror whenever some big box something or other gobbles up yet another street, pushing out all the small business owners just trying to get by. By just typing th...
Stephanie Fierman - Marketing Mojo
http://stephaniefierman.com/category/reputation-management
Building successful businesses and brands – one customer interaction at a time. The Experience Is The Thing. December 4th, 2015. And now a rant on customer experience triggered by Brian Solis. 8216; new book. X: The Experience When Business Meets Design. More on this later). I am a Birchbox. 8221; Twice that day, I took a moment away from my work and clicked through from those emails only to find the product unavailable. Frustrating. As a result, I tweeted. Like all brands, Birchbox’s product is no...
TOTAL LINKS TO THIS WEBSITE
24
stephaniefieldberg.blogspot.com
Stephanie Fieldberg Photography
Saturday, July 26, 2014. Medalta Potteries : Medicine Hat Wedding Photography : Stef and Dane. Subscribe to: Posts (Atom). Medalta Potteries : Medicine Hat Wedding Photograp. Medicine Hat Wedding Photography : Ranch Style Wed. Elkwater Lake Lodge Wedding Venue - Elkwater and Med. Medalta Potteries Wedding Venue - Medicine Hat Wed.
Wedding_Photography_Medicine_Hat_Lethbridge_Index
Stephanie Field Photography | Waterloo,ON
Stephanie Fierman - Marketing Mojo
Building successful businesses and brands – one customer interaction at a time. The evolution of your digital brand: from creating it to erasing it? March 17th, 2015. Anyone who knows me well knows that helping people understand, grow and protect their personal brands online is something I’ve been committed to for some time. I’ve written numerous posts on the subject, including these two recent ones – Thinking it won’t happen to you? And Don’t let social make you stupid. Where do you live? The answer is ...
stephaniefiermanmarketingdaily.blogspot.com
Stephanie Fierman - Marketing Observations Grown Daily
Stephanie Fierman - Marketing Observations Grown Daily. Business guru Stephanie Fierman offers daily observations on the worlds of marketing and consumerism. Marketing Observations Grown Daily now has its own home: www.stephaniefiermanmarketingdaily.com/. We'll expect to see you there soon! And thanks for reading. Subscribe to: Posts (Atom). View my complete profile. Jarvis Cromwell - Reputation Garage. Paul Dunay - Buzz Mktg For Tech. Stephanie Fierman - Marketing Mojo. Stephanie Fierman On Squidoo.
stephaniefiermanmarketingdaily.com
Stephanie Fierman - Marketing Observations Grown Daily
Stephanie Fierman – Marketing Observations Grown Daily. Ron Shevlin's Snarketing. Any is too many, Chevrolet. Tuesday April 14th 2015, 10:59 am. If you’d asked me if I could be surprised by any dumb decisions made by GM in the last few years (aside from borrowing money from taxpayers), I’d have said no… ’til now. The perils of texting while driving (TWD) are widely known. In the U.S. alone, TWD creates a crash risk 23 times. So I suppose Chevrolet decided. If you cannot view the ad below, see it HERE.
Stephanie Figueira - Actor . Presenter . Voice Artist
Actor . Presenter . Voice Artist. 34 634 195 999. 2013 Stand up Comedy. Winner of the 2013 International Stand Up Competition in Spain. Barcelona Improv Group performs monthly English-language improvised comedy shows in Barcelona. A Canadian business woman, an English hipster artist and an Italian teacher and dreamer decide to open a residency for artists in sunny Barcelona. Apokalipstik - Working title. Esoteric gangster comedy world premiere at Sitges international film festival 2014.
stephaniefigueroa.com
美容外科で気になるしわやたるみを取ってもらう
Welcome
stephaniefimbres.deviantart.com
StephanieFimbres (Stephanie Fimbres) - DeviantArt
Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')" class="mi". Window.devicePixelRatio*screen.width 'x' window.devicePixelRatio*screen.height) :(screen.width 'x' screen.height) ; this.removeAttribute('onclick')". Join DeviantArt for FREE. Forgot Password or Username? Traditional Art / Professional. Deviant for 4 Years. 10 Month Core Membership. Daily Pageviews ». Last Visit: 94 weeks ago. Why," you ask?
SOCIAL ENGAGEMENT