Lesley Hall's Sweetie Pies specializes in beautiful hand decorated cookies using only the freshest ingredients. Cookies for any occassion.
http://www.sweetiepiescookies.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
1.4 seconds
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
BUY YOUR DOMAIN
20
YEARS
10
MONTHS
10
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
9
SSL
EXTERNAL LINKS
11
SITE IP
207.150.197.38
LOAD TIME
1.359 sec
SCORE
6.2
Lesley Hall's Sweetie Pies | Specializing in Beautiful Hand Decorated Cookies | sweetiepiescookies.com Reviews
https://sweetiepiescookies.com
Lesley Hall's Sweetie Pies specializes in beautiful hand decorated cookies using only the freshest ingredients. Cookies for any occassion.
sweetiepiescookies.com
Custom Cookies for brides, corporation logos, or any themed event
http://www.sweetiepiescookies.com/custom_cookies.shtml
Web Design and Graphic Design by Off the Page Creations, Tampa Florida.
Celebration cookies make beautiful party favors at weddings, baby showers, and birthday parties
http://www.sweetiepiescookies.com/celebration_cookies.shtml
Our gourmet cookies are beautiful as favors for wedding receptions and rehearsal dinners, baby showers and christenings, and birthday parties for children and adults. Make a lasting impression of your memorable celebration. delight your guests with a sweet token of your appreciation. Complete your party with Sweetie Pies cookies! Web Design and Graphic Design by Off the Page Creations, Tampa Florida.
Holiday Cookies are great on Valentines Day, Easter, Halloween, Thanksgiving or Christmas
http://www.sweetiepiescookies.com/holiday_cookies.shtml
Perfect for Valentines Day, Easter, Halloween, Thanksgiving, and Christmas, Lesley Hall's beautiful hand decorated cookies are sure to bring smiles! These delicious treats are well loved in Easter baskets and Christmas stockings, at place settings on your holiday table or in the cookie jar! Sweetie Pies are always appreciated by good friends and neighbors, teachers, doctors, newspaper deliverers, choir directors, baby sitters and others who bring joy into life!
Silver Tins filled with gourmet hand decorated Cookies make great gifts for Christmas, Valentines Day, Easter, Birthdays, or Just Because
http://www.sweetiepiescookies.com/silver_tins.shtml
Our beautiful silver tins contain one dozen of our "little cookies", each approximately 2 inches and with the same delightful flavor! These delicious cookies are presented in our silver tin with signature seal, festive fill, and hand tied satin bow. Our silver tins make a lovely present. Web Design and Graphic Design by Off the Page Creations, Tampa Florida.
Lesley Hall's Sweetie Pies | Specializing in Beautiful Hand Decorated Cookies
http://www.sweetiepiescookies.com/index.shtml
Lesley Hall's Sweetie Pies specializes in beautiful hand decorated cookies. These scrumptious shortbread cookies are a sweet addition to any special celebration! Sweetie Pies are baked in small batches, especially for you, using only the freshest ingredients, without preservatives. Many say we make the finest cookies in the state of Vermont. Previously available only in fine food shops and gourmet delis throughout New England, we are pleased to now offer our beautiful cookies directly to you!
TOTAL PAGES IN THIS WEBSITE
9
beltrami: Jessica and Tom's engagement session!
http://beltramiblog.blogspot.com/2009/01/jessica-and-jeffs-engagement-session.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Monday, January 26, 2009. Jessica and Tom's engagement session! I just can't wait for this wedding! Jessica and Tom are one of those fun loving couples who you can't help but want to be around! It's so great to see that!
beltrami: CHILDREN'S PORTRAIT CONTEST!!
http://beltramiblog.blogspot.com/2009/01/childrens-portrait-contest.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Sunday, January 25, 2009. This is always one of my favorite. Events that we run! It's such a great way to get your child photographed and who couldn't use an extra $1,000 right now? I know.pretty incredible, huh?
beltrami: January 2009
http://beltramiblog.blogspot.com/2009_01_01_archive.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Monday, January 26, 2009. Jessica and Tom's engagement session! I just can't wait for this wedding! Jessica and Tom are one of those fun loving couples who you can't help but want to be around! It's so great to see that!
beltrami: Jessica and Tom
http://beltramiblog.blogspot.com/2009/01/jessica-and-tom.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Monday, January 26, 2009. Subscribe to: Post Comments (Atom).
beltrami: A great team!!
http://beltramiblog.blogspot.com/2009/01/great-team.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Friday, January 23, 2009. Here's a pic of my most recent bridal show. What a great sucess it was and so much fun! I love to meet brides.and talk and talk and talk about their day! Pretty much, nothing!
beltrami
http://beltramiblog.blogspot.com/2009/01/i-just-wanted-to-give-big-thank-you-to.html
Jessica and Toms engagement session! I just wanted to give a big THANK YOU to Peter Mil. Blogging.hmmm.this is new to me, but I think . West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Thursday, January 22, 2009. I just wanted to give a big THANK YOU. Peter is an incredible musician who has graciously let me use his music on my site! Check him out at www.milessongs.com.
beltrami: March 2009
http://beltramiblog.blogspot.com/2009_03_01_archive.html
West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Saturday, March 14, 2009. It's true.I'm guilty. Of being a "blog neglector"! Time really has a way of getting away from me lately! Not without good reason though! I have some big, exciting news, but just realized I don't have the pics on this computer that I wanted to accompany the news! I love these things! Stay tuned.the big news is coming soon!
beltrami
http://beltramiblog.blogspot.com/2009/02/make-smilebox-scrapbook.html
Make a Smilebox scrapbook. West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Tuesday, February 3, 2009. Make a Smilebox scrapbook. July 8, 2009 at 9:23 AM. When will the winner be announced? Subscribe to: Post Comments (Atom).
beltrami: GUILTY!!
http://beltramiblog.blogspot.com/2009/03/guilty.html
West lebanon, new hampshire. View my complete profile. Http:/ www.beltramiphotography.com. Http:/ www.sweetiepiescookies.com. Http:/ www.milessongs.com. Saturday, March 14, 2009. It's true.I'm guilty. Of being a "blog neglector"! Time really has a way of getting away from me lately! Not without good reason though! I have some big, exciting news, but just realized I don't have the pics on this computer that I wanted to accompany the news! I love these things! Stay tuned.the big news is coming soon!
TOTAL LINKS TO THIS WEBSITE
11
Sweetie Pies Brooklyn
sweetiepiesbyannie.blogspot.com
Sweetie Pies by Annie
Sweetie Pies by Annie. Adventures in the kitchen. Friday, November 29, 2013. Thanksgiving is a time to gather with family and friends, show your thankfulness for your blessings, and gorge on foods you only see once a year. This year, my new husband and I decided to have our first Thanksgiving together at our home, alone, watching Star Wars. Since it was the two of us, I only wanted to make one dessert. But which one? I got this recipe from here. It was easy, quick, and delicious! 2 eggs, lightly beaten.
Sweetie Pie's Cafe | Enjoy!
Sweetie Pie's Cafe. Buttercream Theme by Caroline Moore.
Kärlek Och Mat | Sweetiepiescakes
Man vet ju aldrig hur det kommer att gå, eller om detta kommer bli någonting. Men just nu känns det nästan som att jag inte behöver blir medlem på någon annan av de dejtingsidor som jag hade planerat, utöver Happypancake. Än så länge har jag hittat en sida som innehåller en del bra tips.
sweetiepieschickenandfishfry.com
sweetiepies3-1
Lesley Hall's Sweetie Pies | Specializing in Beautiful Hand Decorated Cookies
Lesley Hall's Sweetie Pies specializes in beautiful hand decorated cookies. These scrumptious shortbread cookies are a sweet addition to any special celebration! Sweetie Pies are baked in small batches, especially for you, using only the freshest ingredients, without preservatives. Many say we make the finest cookies in the state of Vermont. Previously available only in fine food shops and gourmet delis throughout New England, we are pleased to now offer our beautiful cookies directly to you!
Sweetie Pies Desserts
Welcome to Sweetie Pies! We are located in Youngstown, Ohio and specialize in cakes for all occasions! Cookies of all kinds, chocolate favors, and seasonal pumpkin rolls are also available! Visit us on Facebook!
sweetiepieseyes | Helping your pet adjust to blindness
Helping your pet adjust to blindness. Helping your blind pet find the doorway. June 22, 2011. As soon as I learned that Sweetie Pie’s blindness was irreversible, my top priority became transforming our home to accommodate our newly-handicapped family member. And it has worked well… Sweetie Pie has learned that once she finds the mat, she can zero in on getting through the doorway. Canine Progressive Retinal Atrophy. July 27, 2011. Yes, it’s true that I am a big fan of the benefits of chia seeds. I use ch...
sweetiepiesfloristandbakery.com
Home Page
Bakery and Coffee Shop. Stop in, have a seat and enjoy a nice hot cup of coffee. NEED FLOWERS WE CAN HELP- LARGE DELIVERY AREA- SPLENDORA, CLEVELAND, CONROE, KINGWOOD, HUMBLE, NEW CANEY, PORTER, SHEPARD. FROM REGULAR BIRTHDAY CAKES TO STACKED BIRTHDAY CAKES WE CAN DO THEM, JUST GIVE US A CALL. We also offer a variety of fresh sandwiches and salads made only with Boar's Head deli meat, sliced fresh to your preference or also sold by the pound. Cache/wst.opf.4643941.xml. 14548 OLD HWY 59 N. READY TO GO OR.
☺
Cornel and Shari’s adventures in the USA! Last weeks in Atlanta…. May 24, 2012. So this is the last blog about last summer! After this one, there’s only going to be present and future blogs instead of past blogs… :). But sometimes, it’s also nice just to be home again and relax. Of course, that relaxing part would have to wait, cause we still had a lot of things to do, eventhough the official touring part was over. So here’s a little view on those last couple of weeks we spent in the States! He built, re...
Sweetie Pies Bakery
