swifttravellers.com swifttravellers.com

SWIFTTRAVELLERS.COM

Swift Travellers

Select a Vehicle from our fleet for a chauffeur driven experience. Call 9833 55 3333. For ease of booking of buses for Offsite Visits, Group Picnics and other Group Travel plans. Call 9833 55 3333. Is a company associated with. The SWIFT Cold Chain Group. A leading cold chain logistics solutions provider. VEHICLE FOR HIRE VENTURE. This vehicle for hire venture offers the discerning business and leisure Travellers, a choice of choosing and hiring a choice of cars or buses for travel.

http://www.swifttravellers.com/

WEBSITE DETAILS
SEO
PAGES
SIMILAR SITES

TRAFFIC RANK FOR SWIFTTRAVELLERS.COM

TODAY'S RATING

>1,000,000

TRAFFIC RANK - AVERAGE PER MONTH

BEST MONTH

August

AVERAGE PER DAY Of THE WEEK

HIGHEST TRAFFIC ON

Sunday

TRAFFIC BY CITY

CUSTOMER REVIEWS

Average Rating: 4.2 out of 5 with 16 reviews
5 star
8
4 star
5
3 star
2
2 star
0
1 star
1

Hey there! Start your review of swifttravellers.com

AVERAGE USER RATING

Write a Review

WEBSITE PREVIEW

Desktop Preview Tablet Preview Mobile Preview

LOAD TIME

0.4 seconds

CONTACTS AT SWIFTTRAVELLERS.COM

du●●●●●●●●●●●@gmail.com

View this contact

Sharmila Dugal SCM Universal

7, Teja●●●●●●●it Road

91.91●●●●●62327
91.91●●●●●62327
du●●●●●●●●●●●@gmail.com

View this contact

Sharmila Dugal SCM Universal

7, Teja●●●●●●●it Road

91.91●●●●●62327
91.91●●●●●62327
du●●●●●●●●●●●@gmail.com

View this contact

Login

TO VIEW CONTACTS

Remove Contacts

FOR PRIVACY ISSUES

DOMAIN REGISTRATION INFORMATION

REGISTERED
n/a
UPDATED
2014 February 07
EXPIRATION
EXPIRED REGISTER THIS DOMAIN

BUY YOUR DOMAIN

Network Solutions®

NAME SERVERS

1
ns21.managedns.org
2
ns22.managedns.org

REGISTRAR

TRUNKOZ TECHNOLOGIES PVT LTD. D/B/A OWNREGISTRAR.COM

TRUNKOZ TECHNOLOGIES PVT LTD. D/B/A OWNREGISTRAR.COM

WHOIS : whois.ownregistrar.com

REFERRED : http://www.ownregistrar.com

CONTENT

SCORE

6.2

PAGE TITLE
Swift Travellers | swifttravellers.com Reviews
<META>
DESCRIPTION
Select a Vehicle from our fleet for a chauffeur driven experience. Call 9833 55 3333. For ease of booking of buses for Offsite Visits, Group Picnics and other Group Travel plans. Call 9833 55 3333. Is a company associated with. The SWIFT Cold Chain Group. A leading cold chain logistics solutions provider. VEHICLE FOR HIRE VENTURE. This vehicle for hire venture offers the discerning business and leisure Travellers, a choice of choosing and hiring a choice of cars or buses for travel.
<META>
KEYWORDS
1 Car Hire Mumbai
2 Bus Hire Mumbai
3 Vehicle hire company in Mumbai
4 Bus Booking
5 Car Booking
6 AC Non AC Mini Bus Booking
7 Luxury Bus Booking
8 Volvo BookingCar Bus for Hire
9 Vehilce Hiring Services Mumbai
10 Sedans
CONTENT
Page content here
KEYWORDS ON
PAGE
swift travellers,safe sure swift,connect with us,about us,car booking,bus booking,who we are,our service highlights,prompt response,timely service,experienced drivers,competitive price packages,car fleet,luxury car,hire now,sedans,comfort car
SERVER
Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
POWERED BY
PHP/5.4.44
CONTENT-TYPE
utf-8
GOOGLE PREVIEW

Swift Travellers | swifttravellers.com Reviews

https://swifttravellers.com

Select a Vehicle from our fleet for a chauffeur driven experience. Call 9833 55 3333. For ease of booking of buses for Offsite Visits, Group Picnics and other Group Travel plans. Call 9833 55 3333. Is a company associated with. The SWIFT Cold Chain Group. A leading cold chain logistics solutions provider. VEHICLE FOR HIRE VENTURE. This vehicle for hire venture offers the discerning business and leisure Travellers, a choice of choosing and hiring a choice of cars or buses for travel.

LINKS TO THIS WEBSITE

swiftcoldchaingroup.com swiftcoldchaingroup.com

Cold Chain Logistics Solutions in India mumbai

http://www.swiftcoldchaingroup.com/index.php

Bull; Perishable Products. Why SWIFT COLD CHAIN GROUP. SWIFT COLD CHAIN GROUP. Is a fast evolving cold chain logistics solutions provider, with its core business centered on offering a suite of highly competent and professional LONG HAUL AND CITY DISTRIBUTION REFRIGERATED CARGO MOVEMENTS. Need to book a car for corporate travel? Need to book a full bus for corporate or leisure travel? Designed and Maintained by Swift Cold Chain Group.

UPGRADE TO PREMIUM TO VIEW 1 MORE

TOTAL LINKS TO THIS WEBSITE

2

SOCIAL ENGAGEMENT



OTHER SITES

swifttraveldeals.americanpassportnow.com swifttraveldeals.americanpassportnow.com

American Passport Now

Lost or Stolen Passport. Tips for Women Travelers. Travel Document Solutions Experts. A Proud Partner of Swift Travel Deals. Is a well-established passport and visa expediting company and a. Proud partner to Swift Travel Deals. Our mission critical services are focused strictly on. When time is of the essence. In your global business, Meeting deadlines. For global travel is ours! What type of service do you need? 40 Years of Experience. Low Rates and Rush Delivery. US Department of State Licensed.

swifttraveldeals.com swifttraveldeals.com

Swift Travel Deals

Why Book With Us. Request a Free Quote. Need a Travel Deal? Find My Travel Deal. Book Your Travel Online. Travel Information. Before you go. Make Your Payment Online. Make Your Payment Online. Easy Pay Installment Plan Form. Join Our Travel Teams! Become a Travel Consultant. Travel at Discounted Rates. Swift Travel Deals 2015. Enter your search terms below. Swift Travel Deals is an Arkansas based global travel agency that has been featured in over 100 news and media features in over 13 different countries.

swifttraveldeals.cuba-travel-services.com swifttraveldeals.cuba-travel-services.com

Swift Travel Deals | Just another Cuba Travel Services Sites site

We take you to Cuba better than anyone else. 8220;Let us take you on a journey you will never forget…. 8216;The world has been waiting for this day. We’ve done it not only for the world but for Cuba,. To show the world baseball is baseball.’. We take you on a journey that you can see, hear, feel and taste.”. 8211; Yoandy Garlobo. 8220;We will take you on a real insight into Cuba’s People & Culture. Most included and best prices.”. Bob Older Creative Travel. Most extensive programs available. We will inte...

swifttraveler.com swifttraveler.com

Coming Soon - Future home of something quite cool

Future home of something quite cool. If you're the site owner. To launch this site. If you are a visitor. Please check back soon.

swifttravelintl.com swifttravelintl.com

Travel Agency Lahore | Cheap Air Tickets | Swift Travel International

Most exciting and latest tour deals. Starting From Rs. 17,500. Starting From Rs. 17,500. Starting From Rs. 35,000. Welcome To Swift Travel. Swift Travel International is a Lahore based full service travel agency. We offer air tickets,. Tour packages, Hajj and Umrah packages and Visa services. We are committed to provide the best. Quality services at affordable rates. We provide the best hotel booking services in Lahore, Get the best hotel deals and promotions with swift travels international. Choosing th...

swifttravellers.com swifttravellers.com

Swift Travellers

Select a Vehicle from our fleet for a chauffeur driven experience. Call 9833 55 3333. For ease of booking of buses for Offsite Visits, Group Picnics and other Group Travel plans. Call 9833 55 3333. Is a company associated with. The SWIFT Cold Chain Group. A leading cold chain logistics solutions provider. VEHICLE FOR HIRE VENTURE. This vehicle for hire venture offers the discerning business and leisure Travellers, a choice of choosing and hiring a choice of cars or buses for travel.

swifttravels.com swifttravels.com

swifttravels.com -

swifttravelservices.com swifttravelservices.com

Swifttravelservices.com

swifttravelservices.nl swifttravelservices.nl

swifttravelservices.nl

111;preismet@swifttravelservices.nl. Somaliland & Djibouti. Veel spectaculaire vogels en ook nog the Big Five tijdens de Zuid-Afrikaanse lente onder deskundige leiding! Complete goed verzorgde vogelreis van Eilat tot en met de Hermon tijdens het hoogtepunt van de voorjaarstrek! Vogel-, natuur- en cultuurreizen in het land waar de gastvrijheid is uitgevonden. Ook reizen voor zowel beginnende als ervaren vogelaars en natuurliefhebbers. De Hoorn van Afrika. Paste your AdWords Remarketing code here.

swifttraveltours.wordpress.com swifttraveltours.wordpress.com

Protected Blog › Log in

Https:/ swifttraveltours.wordpress.com/. Is marked private by its owner. If you were invited to view this site, please log in. Below Read more about privacy settings. Larr; Back to WordPress.com.

swifttravelug.com swifttravelug.com

Account Suspended! - Tailored Technologies

This account has been suspended. Please Contact billing at billing@tailoredtechug.com.