This is the initial production of the The Sky's The Limit Productions, LLC. The rating for the Film is projected to be PG. The projected demographic for the Film is intended for a diverse age group of men and women from their early twenties and older.
http://www.theskysthelimitproductions.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
0.8 seconds
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
BUY YOUR DOMAIN
12
YEARS
6
MONTHS
15
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
0
SSL
EXTERNAL LINKS
10
SITE IP
72.167.126.154
LOAD TIME
0.828 sec
SCORE
6.2
The Skys The Limit Productions, LLC | Elevating Story Telling To New Heights | theskysthelimitproductions.com Reviews
https://theskysthelimitproductions.com
This is the initial production of the The Sky's The Limit Productions, LLC. The rating for the Film is projected to be PG. The projected demographic for the Film is intended for a diverse age group of men and women from their early twenties and older.
October | 2014 | Donna Laemmlen
https://donnalaemmlen.com/2014/10
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. Monthly Archives: October 2014. Gripped: Killer Pillar has wrapped! October 23, 2014. A feature film that I was lucky enough to be a co-writer on has wrapped and is now in the grueling post-production phase. Please check out our facebook page https:/ www.facebook.com/grippedthemovie? For updates, photos and videos of the shoot. The website is https:/ www.grippedthemovie.com/#! Gripped: Killer Pillar has wrapped!
August | 2014 | Donna Laemmlen
https://donnalaemmlen.com/2014/08
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. Monthly Archives: August 2014. August 9, 2014. We finished the shoot on time and, thanks to our wonderfully talented director, cast and crew, we are very excited to start post-production. A rough assembly should be ready early September. Stay tuned! Gripped: Killer Pillar has wrapped! On Cinequest Film Festival…. On Cinequest Film Festival…. On Cinequest Film Festival. On Cinequest Film Festival. On Cinequest Film Festival.
Cinequest Film Festival | Donna Laemmlen
https://donnalaemmlen.com/2014/01/30/cinequest-film-festival/comment-page-1
Writer, Teacher, Story Analyst. Skip to primary content. January 30, 2014. My feature animation screenplay, Sheila the Gila Monster, will be a part of the Writers Celebration Day at the Cinequest Film Festival, when they will give the Maverick Spirit Award to Neil Gaiman, author of Coraline. Come and join us on March 9th at 1:30 PM! Http:/ www.cinequest.org/screenplay submissions. This entry was posted in Uncategorized. 4 thoughts on “ Cinequest Film Festival. February 5, 2014 at 12:12 am. Ciao, Sal Bono.
September | 2014 | Donna Laemmlen
https://donnalaemmlen.com/2014/09
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. Monthly Archives: September 2014. September 10, 2014. The fall semester has begun and so has our post-production phase. With a new producer on board, we are looking forward to shaping. Into the little masterpiece we all hope it will be. We also have an excellent person manning our PR — Reid Basso and Three Doves Media. Here is a taste of what he is saying about us! Https:/ m.facebook.com/story.php?
donnalaemmlen | Donna Laemmlen
https://donnalaemmlen.com/author/donnalaemmlen
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. August 18, 2016. I’m happy to report that my short story, “Photosynthesis,” will be forthcoming in the British publication. This coming fall. Their beautiful magazine is distributed in twenty-four countries around the world. I’m going international! October 16, 2015. Art of In Freefall. Thank you to the artist, Roselyne Lougnon, for this wonderful image. Stay tuned! August 12, 2015. April 5, 2015. October 23, 2014. The fa...
Donna Laemmlen | Writer, Teacher, Story Analyst | Page 2
https://donnalaemmlen.com/page/2
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. Newer posts →. July 17, 2014. We successfully met our Indiegogo campaign goal last week, and now the amazing cast and crew are hard at work bringing our shared vision to life. Thank you to everyone who supported our campaign! Stay tuned for updates…. June 12, 2014. The campaign to fund our short film,. Is finally underway. And to make things even more exciting, we received 20% of our funding on the first day! May 12, 2014.
Uncategorized | Donna Laemmlen
https://donnalaemmlen.com/category/uncategorized
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. August 18, 2016. I’m happy to report that my short story, “Photosynthesis,” will be forthcoming in the British publication. This coming fall. Their beautiful magazine is distributed in twenty-four countries around the world. I’m going international! October 16, 2015. Art of In Freefall. Thank you to the artist, Roselyne Lougnon, for this wonderful image. Stay tuned! August 12, 2015. April 5, 2015. October 23, 2014. The fa...
April | 2015 | Donna Laemmlen
https://donnalaemmlen.com/2015/04
Writer, Teacher, Story Analyst. Skip to primary content. Skip to secondary content. Monthly Archives: April 2015. April 5, 2015. And that’s a wrap on pick-up shots for. Gripped: Killer Pillar has wrapped! On Cinequest Film Festival…. On Cinequest Film Festival…. On Cinequest Film Festival. On Cinequest Film Festival. On Cinequest Film Festival. Blog at WordPress.com. Blog at WordPress.com. Follow “Donna Laemmlen”. Get every new post delivered to your Inbox. Build a website with WordPress.com.
indiecatholicauthors.wordpress.com
Meet Our Authors |
https://indiecatholicauthors.wordpress.com/meet-our-authors
McCracken and the Lost Island. McCracken and the Lost Valley. McCracken and the Lost City. Carolyn Astfalk, Author. The Five Day Crucifixion. The Sky’s The Limit Productions. Saying Yes to God. Evolution, Faith, and the Future of Catholicism. Fr Robert J. Carr. A Body in Prayer. A Body in Prayer. John C. Connell. Catholics Have Courage: 40 Days to Beating Stress, God’s Way. Catholics Mean Business: 30 Days to Managing Your Work Week, God’s Way. John C. Connell. The Tales of the Magic Rocking Chair Book 2.
TOTAL LINKS TO THIS WEBSITE
10
Blog Music de TheSkysTheLimit - You are my most beautiful melody. - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. You are my most beautiful melody. 9679;La plupart du t℮mps la musiqu℮ qu℮ t'℮cout℮ r℮fl℮t℮ l'℮tat d' ℮sprit dans l℮qu℮l tu t℮ trouv℮ . ♪. Autre / Non spécifié. Mise à jour :. Abonne-toi à mon blog! You are my most beautiful melody. Jason Derulo - Don't Wanna Go Home. Numéro de la piste. Ajouter à mon blog. Jason Derulo - Don't Wanna Go Home. Ajouter à mon blog. One Direction - What Makes You Beautiful. Ajouter à mon blog. Joe Jonas - Love Slayer. ♥. Pitbull -...
theskysthelimitandpigsmightfly.tumblr.com
The Sky's The Limit And Pigs Might Fly.
The Sky's The Limit And Pigs Might Fly. A Collection of things and Ideas that I love - Jo Richardson. String empty cans hot glue gun = pretty plant pots. Making minion bunting for a Despicable Me party for a friend :). Being wrong has never felt so right. — If Disney Villains Were Gorgeous. Jafar looks like the guy who got kicked out for being too handsome. The red is back! The Minimalist Theme — Tumblr themes. By Pixel Union Powered by Tumblr.
theskysthelimitblog.wordpress.com
The Sky's the Limit | Believe to Achieve
The Sky's the Limit. Thanks for dropping by The Sky's the Limit! Take a look around and grab the RSS feed. To stay updated. See you around! Latest Entries ». Angel with a Broken Wing. Mdash; Leave a comment. October 18, 2013. Angel with a Broken Wing. Angel with a Broken Wing. Mdash; 1 Comment. Angel with a Broken Wing. By Beatrece Varga-PTK Vice-President. See the halo that’s tarnished. By years of abuse. The wing that is broken. But still of great use. An angel’s been hidden under the clay. I am the su...
Employee Motivation | Performance Management
Since 1999, THE SKY'S THE LIMIT CONSULTING, INC. Has been offering the following services:. Click Play Icon To Hear Message. Click Play Icon To Hear Message. This text will be replaced by the flash music player. This text will be replaced by the flash music player. TRAINING HUMAN RESOURCE DEVELOPMENT FACILITATION. Hellip;….No matter what type of organization you are in, there are PEOPLE. Our strength is in the PEOPLE. Side of doing business.
www.theskysthelimitinc.com
theskysthelimitproductions.com
The Skys The Limit Productions, LLC | Elevating Story Telling To New Heights
Teaser Cast and Crew. The Five-Day Crucifixion" novel has been published as an eBook on SmashWords.com! The eBook will be also be available through all major Internet retailers and tablet media formats for your reading pleasure. Please visit https:/ SmashWords.com. To purchase the book or download a sample of the novel to check out. Guessing a second chance, seconds the failure. The story depicts John's travails throughout his journey by articulating the concepts of forgiveness and perseverance, and how ...
TheSkysTheLimit
theskysthelimittravel.wordpress.com
The Skys The Limit Travel | "Something For Everyone"
The Skys The Limit Travel. August 26, 2011. ATLANTIC CITY SEPT 10, 2011. Posted in One Day Getaways. August 26, 2011. The city that never sleeps! SEPTEMBER 17-23, 2011. PRICE: PER PERSON $595.00. BASED ON DOUBLE OCCUPANCY. HOTEL STAY IN LAS VEGAS. DEPOSIT OF $100.00 A.S.A.P. VIEW FLYER – Las Vegas 2011. August 25, 2011. The Christmas Celebration — December 3, 2011. An original, electrifying holiday spectacular. In Maryland. DECEMBER 3, 2011. With Marvin Sapp, Donnie McClurkin, Bebe and Cece Winans. FOR R...
The Sky's Still Blue
The Sky's Still Blue. Oh the clouds open up above, through my window. Sunday, June 23, 2013. Or, Why I’m Fed Up With the. This blog post has been percolating in my subconscious for several years, and the summer solstice brought it to the forefront. I’m not going to tackle “The Bikini Question” head-on, but rather examine some aspects of modesty that aren’t talked about as much. In many ways this is a letter to my younger self, who wondered and worried about this so much. Bathing suit is modest? Let’...
Blog de TheSkyStillBlue - The Sky's still blue - Skyrock.com
Mot de passe :. J'ai oublié mon mot de passe. Plus d'actions ▼. S'abonner à mon blog. Création : 22/06/2013 à 07:38. Mise à jour : 12/04/2014 à 08:56. The Sky's still blue. 8220;Derrière les nuages le ciel est toujours bleu.” Buddha. Mon petit sondage avait remporté le plus de vote pour que j'écrive une nouvelle fiction donc la voici, la voilà. Elle est très différente de la précédente mais j'espère qu'elle vous plaira tout autant. Je suis vraiment contente de recommencer à écrire. Ou poster avec :.
STRATO
