Charged with a crime in Richmond, VA? Hire former prosecution with experience. Contact Attorney James A. Bullard, Jr. today for a confidential case evaluation!
http://www.virginiacriminaldefenselawfirm.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Thursday
LOAD TIME
0.2 seconds
Rustin Kretz
Rustin Kretz
28480 A●●●●●●●tanford
Val●●●cia , California, 91355
UNITED STATES
View this contact
Rustin Kretz
Rustin Kretz
28480 A●●●●●●●tanford
Val●●●cia , California, 91355
UNITED STATES
View this contact
Rustin Kretz
Rustin Kretz
28480 A●●●●●●●tanford
Val●●●cia , California, 91355
UNITED STATES
View this contact
BUY YOUR DOMAIN
12
YEARS
9
MONTHS
27
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
20
SSL
EXTERNAL LINKS
3
SITE IP
216.87.172.187
LOAD TIME
0.186 sec
SCORE
6.2
Richmond Criminal Defense Lawyer | James A. Bullard Jr. PC | virginiacriminaldefenselawfirm.com Reviews
https://virginiacriminaldefenselawfirm.com
Charged with a crime in Richmond, VA? Hire former prosecution with experience. Contact Attorney James A. Bullard, Jr. today for a confidential case evaluation!
virginiacriminaldefenselawfirm.com
Firm Profile | James A. Bullard Jr., P.C.
http://www.virginiacriminaldefenselawfirm.com/Firm-Profile.aspx
Firm Profile: James A. Bullard Jr. P.C. James A. Bullard, Jr., P.C. is a Richmond law firm that was established to provide aggressive, creative and superior representation in the areas of criminal defense and personal injury throughout Central Virginia area and beyond. Mr. Bullard and our staff work diligently to provide quality representation to those fighting criminal charges, and we can help you challenge the allegations brought against you. We have been able to achieve dismissal and acquittal on beha...
Disorderly Conduct | Richmond Criminal Defense Lawyer
http://www.virginiacriminaldefenselawfirm.com/Criminal-Defense/Disorderly-Conduct.aspx
Richmond Disorderly Conduct Lawyer. Criminal Defense Attorney in Richmond, Virginia. Disorderly conduct is defined as behavior intended to cause public inconvenience, annoyance or alarm, or recklessly creating a public risk. Disorderly conduct can be charged when this behavior occurs in a public place including a street, building, public transport or any public place. Any actions designed to incite alarm or violence can be considered disorderly conduct. The information on this website is for general info...
Criminal Defense in Richmond | VA Defense Lawyer
http://www.virginiacriminaldefenselawfirm.com/Criminal-Defense.aspx
Criminal Defense Attorney in Richmond, VA. Richmond Criminal Defense Lawyer. Looking for a knowledgeable criminal defense attorney in Richmond, VA? When it comes to defending yourself against criminal charges, it is absolutely essential to hire an attorney who will aggressively represent your interests no matter what the circumstances of your case may be. At James A. Bullard, Jr. P.C. Criminal Cases We Handle:. Underage Possession of Alcohol. Charged with a crime in Richmond, Virginia? The information on...
Richmond Sex Crimes Lawyer | James A. Bullard Jr. PC
http://www.virginiacriminaldefenselawfirm.com/Criminal-Defense/Sex-Crimes.aspx
Richmond Sex Crimes Attorney. Call James A. Bullard Jr. P.C. for Help! Looking for an attorney for a sex crime case in Richmond? By involving our professional and discreet firm as soon as possible, we may be able to prevent or limit any unnecessary damage to your career, family and reputation. Our determined legal team will aggressively defend you against allegations of a sex crime as well as against criminal charges for a sex crime. Sex crime charges may include:. Or call our team at (804) 622-5332.
Federal Crime Charges | Richmond Federal Defense Lawyer
http://www.virginiacriminaldefenselawfirm.com/Criminal-Defense/Federal-Crimes.aspx
Richmond Federal Defense Lawyer. Defense Against Federal Charges in Virginia. Searching for a lawyer for a federal crime case in Richmond? If you stand accused of a federal crime, it is absolutely essential to hire a Richmond criminal defense lawyer. Serious Consequences of a Federal Crime Conviction. Bank robberies, serious gun offenses, large-scale drug crimes, terrorist activity, arson. The Importance of Aggressive Defense. Need a lawyer for a federal crime case in Richmond? When fighting a federal cr...
TOTAL PAGES IN THIS WEBSITE
20
virginiacriminaldefense-lawyer.com
Default Web Site Page
If you are the owner of this website, please contact your hosting provider: [email protected]. It is possible you have reached this page because:. The IP address has changed. The IP address for this domain may have changed recently. Check your DNS settings to verify that the domain is set up correctly. It may take 8-24 hours for DNS changes to propagate. It may be possible to restore access to this site by following these instructions. For clearing your dns cache. There has been a server misconfiguration.
Find the best domain names to register
Register a Domain Name Who Owns This Domain? The domain name registration process for your businesses web site begins here. Register a great domain name with Verio from only $9.95 and receive a free 3 page website and email account. 1 Find Your Domain Name. 2 Choose Your Extensions. Enter up to 5 domain names. Couk ($38 for 2 years). Create the site you want with Verio hosting plan options. Verio is your strategic partner for top-tier hosting for complex websites and dedicated hosting.
Virginia Criminal Defense Attorney: Virginia Beach
Monte E. Kuligowski, P.C. Attorney and Counselor at Law. 3640 S. Plaza Trl., Suite 202. Virginia Beach, Virginia. 160; . 160; . Virginia Criminal Defense Attorney. When You Need an Experienced Defense Lawyer. If you have been charged with a serious offense that carries the possibility of jail time, including D.U.I. or drug possession, you have the right to retain an experienced defense lawyer who knows how to protect your legal rights. Atty Monte E. Kuligowski. Credit card payment accepted. When yo...
virginiacriminaldefenseattorney.net
Virginia Beach Suffolk Norfolk Portsmouth & Chesapeake Criminal Defense Attorney
Do You Need a Virginia Criminal Defense Attorney? Contact the Law Office of Steve C. Taylor. Contact the office nearest you today! Chesapeake Criminal Defense Attorney. 757-482-5705, 133 Mount Pleasant Road, Chesapeake, Virginia. Norfolk Criminal Defense Attorney. 757-588-5872, 7508 Granby St, Norfolk, Va. Hampton Roads Criminal Defense Attorney. 757-455-9590 735 Newtown Rd #101 Norfolk, Va. Virginia Beach Criminal Defense Attorney. 757-473-9597 522 S. Independence blvd #102D Va Beach, Virginia. The Law ...
virginiacriminaldefenseattorneys.com
www.virginiacriminaldefenseattorneys.com
virginiacriminaldefenselawfirm.com
Richmond Criminal Defense Lawyer | James A. Bullard Jr. PC
How Can I Fight My DUI Charges? Click here to find out how to fight it! Case Result: Marijuana Possession Charge Dismiss. Click here to read more. Successful Murder Charges Defense. Commonwealth v. D. M. -. Acquittal in first degree murder case and use of a firearm, jury trial in Richmond Circuit Court. Commonwealth v. D. H. -. Negotiated dismissal of conspiracy to distribute more than 5 pounds of marijuana and attempt to distribute more than 5 pounds of marijuana in Bedford County Circuit Court. The qua...
virginiacriminaldefenselawyerattorney.com
Virginia Criminal Defense Lawyer Attorney
Criminal Defense HelpLine: 866-757-6949. 8211; Main Menu –. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Internet Sex Crimes Defense. Felon in Possession Defense. Unlawful Possession of Firearm Defense. Receiving Stolen Property Defense. White Collar Crimes Defense. Credit Card Fraud Defense. Other Area of Law. Accessory to Crime Defense. Aiding & Abetting Defense. Criminal Defense Practice Area. PCS Drug Possession Defense. Hit and Run Defense. Other Area of Law.
virginiacriminaldefenselawyers.net
Virginia Criminal Defense Lawyers
Virginia Criminal Defense Lawyers. Reckless Driving Virginia Ticket. Reckless driving in Virginia is a class 1 misdemeanor. How serious is a class 1 misdemeanor in Virginia. It is serious enough that it can land you in jail. Are you really going to jail for a reckless driving ticket in Virginia. The honest answer is that in most instances, no. But it is a possibility if you are not careful. Talk to a reckless driving lawyer in Virginia. Reckless Driving Virginia Ticket. Reckless Driving Virginia Ticket.
Virginia Beach Suffolk Norfolk Portsmouth & Chesapeake Criminal Law Attorney g
Virginia Criminal Law Attorney. Contact the office nearest you today! 757-482-5705 133 Mount Pleasant Road Chesapeake, Virginia. 757-588-5872 7508 Granby St Norfolk, Va. Norfolk/Va Beach Accident Attorney. 757-455-9590 735 Newtown Rd #101 Norfolk, Va. Virginia Beach Accident Attorney. 757-473-9597 522 S. Independence blvd #102D Va Beach, Virginia. 757-465-9534 5660 Portsmouth Blvd Portsmouth, Va. 757-539-4114 302 N. Main St. Suffolk, Virginia. Chesapeake General District Court. Portsmouth, Virginia 23705.
Virginia Criminal Lawyer | Defense Attorney Steve Duckett
Free Confidential Case Evaluation. Yes, I want a free Confidential Consultation. Call Us Confidentially (703) 940-1570. Steve Duckett Attorney At LAw. The Truck Accident Law Group. Fighting for Your Defense. Assault and Domestic Violence. One of the more commonly prosecuted crimes in the Commonwealth of Virginia and throughout the nation, driving under the influence carries very serious penalties, even with a first time conviction. A first time DUI violation carries a maximum penalty of a year in jai...
Richmond Criminal Defense Lawyer David Long - 804.285.3888
CALL 804.285.3888. Virginia Criminal Lawyer David Long. Minor in Possession of Alcohol (MIP). Richmond Criminal Defense Lawyer – 804.285.3888. Experienced Virginia Criminal Lawyer. Petty or Grand Larceny. Drug Possession or Distribution. Call Our Criminal Lawyers. If you’ve been arrested for a criminal offense in Virginia, our criminal defense lawyers can help. Virginia DUI DWI Arrest. When your blood alcohol concentration is 0.2% or higher when you are arrested, your penalty will include a mandatory...
SOCIAL ENGAGEMENT